3N9U: PDB entry 3N9U

Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM domain) of Human Cleavage Factor Im. Determined by X-ray diffraction at 1.92 Å resolution. Released 21 Jul 2010.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,214
Mol. weight: 89.14 kDa
Released: 21 Jul 2010

Explore 3N9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N9U contains 26 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	24-30	7
β-strand	36-39	4	1
β-strand	41	1	2
α-helix	42-44	3
β-strand	45-50	6	3
α-helix	60-74	15
β-strand	77-84	8	4
β-strand	85-88	4	2
β-strand	91-100	10	2
β-strand	103-105	3	2
β-strand	108-110	3	4
α-helix	111-112	2
α-helix	117-129	13
α-helix	135-137	3
β-strand	140-150	11	4
β-strand	158	1	4
β-strand	170-178	9	4
α-helix	179-180	2
β-strand	183-188	6	3
β-strand	192-197	6	2
α-helix	198-201	4
α-helix	205-212	8
α-helix	215-219	5
β-strand	223-226	4	1

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	5
β-strand	41	1	6
α-helix	42-44	3
β-strand	45-50	6	7
α-helix	60-73	14
β-strand	77-84	8	8
β-strand	85-88	4	6
β-strand	91-99	9	6
β-strand	103-105	3	6
β-strand	108-110	3	8
α-helix	111-112	2
α-helix	117-129	13
α-helix	135-137	3
β-strand	140-150	11	8
β-strand	158	1	8
β-strand	170-178	9	8
α-helix	179-180	2
β-strand	183-188	6	7
β-strand	192-197	6	6
α-helix	198-201	4
α-helix	205-212	8
α-helix	215-219	5
β-strand	222-226	5	5

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	83-87	5	9
α-helix	95-104	10
β-strand	110-117	8	9
β-strand	124-132	9	9
α-helix	135-144	10
β-strand	149-150	2	10
β-strand	153-154	2	10
β-strand	156-159	4	9
α-helix	162-176	15

Chain I: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	85-87	3	11
α-helix	95-103	9
β-strand	112-117	6	11
β-strand	124-131	8	11
α-helix	139-144	6
β-strand	149-150	2	12
β-strand	153-154	2	12
α-helix	155	1
β-strand	156-158	3	11
α-helix	162-172	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cleavage and polyadenylation specificity factor subunit 5	A, B	protein	230	Homo sapiens	O43809 (AlphaFold model)
Cleavage and polyadenylation specificity factor subunit 7	C, I	protein	156	Homo sapiens	Q8N684 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3N9U_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKD
SSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDE
VEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLV
QLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Sequence of entity 2 (C, I), FASTA

>3N9U_2 Cleavage and polyadenylation specificity factor subunit 7 (chains C, I)
MHHHHHHSSGVDLGTENLYFQSMEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYV
GSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLP
GKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPR

Primary citation

Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM domain) of Human Cleavage Factor Im. Tresaugues, L., Welin, M., Arrowsmith, C.H. et al. To be published.

Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5R4Q 1.49 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4R 1.5 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R67 1.52 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4S 1.61 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4T 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4P 1.78 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BHO 1.8 Å, Crystal Structure of the 25kDa Subunit of Human Cleavage factor Im with Ap4A
5R64 1.84 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BAP 1.85 Å, Crystal Structure of the 25 kDa Subunit of Human Cleavage Factor Im
2CL3 1.9 Å, Crystal structure of human Cleavage and Polyadenylation Specificity Factor 5 (CPSF5)
5R4U 1.92 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R66 2.02 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…

Browse structure collections

About this viewer

MolViewer shows 3N9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.