3NY5: Serine/threonine-protein kinase B-raf

Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens. Northeast Structural Genomics Consortium Target HR4694F. Determined by X-ray diffraction at 1.99 Å resolution. Released 28 Jul 2010.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,824
Mol. weight: 45.05 kDa
Released: 28 Jul 2010

Explore 3NY5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NY5 contains 16 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	156-161	6	1
β-strand	165-170	6	1
β-strand	176	1	2
α-helix	177-186	10
α-helix	192-194	3
β-strand	195-199	5	1
β-strand	206-208	3	1
β-strand	212	1	3
β-strand	213	1	2
α-helix	214-217	4
β-strand	221-226	6	1
α-helix	227-228	2
β-strand	232	1	4

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	156-161	6	5
β-strand	165-170	6	5
β-strand	176	1	6
α-helix	177-186	10
α-helix	192-194	3
β-strand	195-200	6	5
β-strand	205-208	4	5
β-strand	212	1	4
β-strand	213	1	6
α-helix	214-217	4
β-strand	221-226	6	5
α-helix	227-228	2
β-strand	232	1	3

Chain C: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	156-161	6	7
β-strand	165-170	6	7
β-strand	176	1	8
α-helix	177-186	10
α-helix	192-194	3
β-strand	195-199	5	7
β-strand	206-208	3	7
β-strand	213	1	8
α-helix	214-217	4
β-strand	221-226	6	7
α-helix	227-228	2

Chain D: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	156-161	6	9
β-strand	165-170	6	9
β-strand	176	1	10
α-helix	177-187	11
α-helix	192-194	3
β-strand	195-199	5	9
β-strand	206-207	2	9
β-strand	213	1	10
α-helix	214-217	4
β-strand	221-226	6	9
α-helix	227-228	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase B-raf	A, B, C, D	protein	96	Homo sapiens	P15056 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3NY5_1 Serine/threonine-protein kinase B-raf (chains A, B, C, D)
MGHHHHHHSHMQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQ
DGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNF

Primary citation

Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens. Vorobiev, S., Su, M., Seetharaman, J. et al. To be published.

Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSO 1.5 Å, Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
8JNB 1.62 Å, CRAF ras-binding domain chimera, ligand complex
8C7X 1.65 Å, Crystal structure of BRAF in complex with a hybrid compound 6
8C7Y 1.65 Å, Crystal structure of BRAF V600E in complex with a hybrid compound 6
9EW6 1.65 Å, Binary structure of 14-3-3s and BRAF phosphopeptide (pS365)
8JNA 1.7 Å, CRAF ras-binding domain chimera, apo form
9BP8 1.73 Å, Crystal structure of BRAF kinase domain with PF-07799933
5VYK 1.75 Å, Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1
9BFB 1.92 Å, Crystal structure of BRAF kinase domain with PF-07284890
7K0V 1.93 Å, Crystal structure of bRaf in complex with inhibitor GNE-0749
5ITA 1.95 Å, Crystal Structure of BRAF Kinase Domain Bound to AZ-VEM
4XV9 2.0 Å, B-Raf Kinase domain in complex with PLX5568

Browse structure collections

About this viewer

MolViewer shows 3NY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.