5VYK: BRS domain of BRAF

Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1. Determined by X-ray diffraction at 1.75 Å resolution. Released 14 Feb 2018.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,171
Mol. weight: 51.35 kDa
Released: 14 Feb 2018

Explore 5VYK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VYK contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	34-61	28
α-helix	67-93	27
α-helix	101-104	4
α-helix	106	1
α-helix	108	1
α-helix	109-115	7
α-helix	120-124	5
α-helix	132-137	6
α-helix	140-149	10
α-helix	154-170	17
α-helix	1043-1068	26
α-helix	1076-1103	28

Chain C: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	34-61	28
α-helix	67-93	27
α-helix	101-104	4
α-helix	106	1
α-helix	108	1
α-helix	109-115	7
α-helix	120-124	5
α-helix	132-137	6
α-helix	140-149	10
α-helix	154-170	17
α-helix	1043-1068	26
α-helix	1076-1104	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of BRS domain of BRAF and CC-SAM domain of KSR1,Serine/threonine-protein kinase…	A, C	protein	232	Homo sapiens	P15056 (AlphaFold model), Q8IVT5 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5VYK_1 Chimera protein of BRS domain of BRAF and CC-SAM domain of KSR1,Serine/threonine-protein kinase B-raf (chains A, C)
GAMEGGAGAAASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQQEIRTLEAKLVRY
ICKQRQCKLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKV
KETLRRCGASGDECGRLQYALTCLRKVTGGSGSGSGSSSAADPAIPEEVWNIKQMIKLTQ
EHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFS

Primary citation

MEK drives BRAF activation through allosteric control of KSR proteins. Lavoie, H., Sahmi, M., Maisonneuve, P. et al. Nature (2018) 554:549-553. DOI 10.1038/nature25478 · PubMed

Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSO 1.5 Å, Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
8JNB 1.62 Å, CRAF ras-binding domain chimera, ligand complex
8C7X 1.65 Å, Crystal structure of BRAF in complex with a hybrid compound 6
8C7Y 1.65 Å, Crystal structure of BRAF V600E in complex with a hybrid compound 6
9EW6 1.65 Å, Binary structure of 14-3-3s and BRAF phosphopeptide (pS365)
8JNA 1.7 Å, CRAF ras-binding domain chimera, apo form
9BP8 1.73 Å, Crystal structure of BRAF kinase domain with PF-07799933
9BFB 1.92 Å, Crystal structure of BRAF kinase domain with PF-07284890
7K0V 1.93 Å, Crystal structure of bRaf in complex with inhibitor GNE-0749
5ITA 1.95 Å, Crystal Structure of BRAF Kinase Domain Bound to AZ-VEM
3NY5 1.99 Å, Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo…
4XV9 2.0 Å, B-Raf Kinase domain in complex with PLX5568

Browse structure collections

About this viewer

MolViewer shows 5VYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.