3O41: 101F Fab

Crystal Structure of 101F Fab Bound to 15-mer Peptide Epitope. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Oct 2010.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Mus musculus, Human respiratory syncytial virus A
Chains: 6
Atoms: 7,652
Mol. weight: 100.19 kDa
Released: 13 Oct 2010

Explore 3O41 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O41 contains 35 α-helices and 94 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	14
β-strand	11-12	2	15
α-helix	16-17	2
β-strand	18-25	8	14
β-strand	34-39	8	16
β-strand	46-52	7	16
β-strand	57-59	3	16
α-helix	61-66	6
β-strand	67-72	6	14
α-helix	73-75	3
β-strand	77-82	6	14
α-helix	84-86	3
β-strand	88-96	9	16
β-strand	100B-103	4	16
β-strand	107-109	3	16
β-strand	110-111	2	15
α-helix	114-116	3
β-strand	117	1	17
α-helix	118-119	2
β-strand	120-124	5	18
β-strand	135-145	11	18
β-strand	146	1	17
β-strand	151-154	4	19
α-helix	155-157	3
β-strand	163-165	3	18
α-helix	166-168	3
β-strand	169-171	3	18
β-strand	174-184	11	18
β-strand	194-199	6	19
α-helix	200-202	3
β-strand	204-209	6	19

Chain B: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	20
β-strand	10-14	5	21
β-strand	19-25	7	20
β-strand	27C-27D	2	22
β-strand	30-31	2	22
β-strand	33-38	6	21
β-strand	45-49	5	21
β-strand	53-54	2	21
α-helix	55	1
β-strand	62-67	6	20
β-strand	70-75	6	20
α-helix	80-82	3
β-strand	84-90	7	21
β-strand	93	1	23
β-strand	98	1	21
β-strand	102-107	6	21
β-strand	111	1	24
α-helix	112-113	2
β-strand	114-118	5	25
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	25
β-strand	140	1	24
β-strand	145-150	6	26
β-strand	153-155	3	26
β-strand	159-163	5	25
α-helix	164-167	4
β-strand	173-182	10	25
α-helix	183-186	4
β-strand	191-197	7	26
α-helix	204	1
β-strand	205-210	6	26

Chains C and P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	435	1	23

Chain H: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	8
β-strand	11-12	2	9
α-helix	17	1
β-strand	18-25	8	8
β-strand	34-39	8	10
β-strand	46-52	7	10
β-strand	57-59	3	10
α-helix	64-66	3
β-strand	67-72	6	8
α-helix	73-75	3
β-strand	77-82	6	8
α-helix	84-86	3
β-strand	88-96	9	10
β-strand	102-103	2	10
β-strand	107-109	3	10
β-strand	110-111	2	9
α-helix	115-116	2
β-strand	117	1	11
α-helix	118-119	2
β-strand	120-124	5	12
β-strand	135-145	11	12
β-strand	146	1	11
β-strand	151-154	4	13
α-helix	155-157	3
β-strand	163-165	3	12
α-helix	166-168	3
β-strand	169-171	3	12
β-strand	174-184	11	12
β-strand	194-199	6	13
α-helix	200-202	3
β-strand	204-209	6	13

Chain L: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	27C-27D	2	3
β-strand	30-31	2	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	93	1	4
β-strand	98	1	2
β-strand	102-107	6	2
β-strand	111	1	5
α-helix	112-113	2
β-strand	114-118	5	6
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	6
β-strand	140	1	5
β-strand	145-150	6	7
β-strand	153-155	3	7
β-strand	159-163	5	6
α-helix	164-167	4
β-strand	173-182	10	6
α-helix	183-186	4
β-strand	191-197	7	7
α-helix	204	1
β-strand	205-210	6	7
α-helix	211-213	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mouse monoclonal antibody 101F Fab light chain	B, L	protein	218	Mus musculus
Mouse monoclonal antibody 101F Fab heavy chain	A, H	protein	220	Mus musculus
Fusion glycoprotein F1	C, P	protein	17	Human respiratory syncytial virus A	P03420

Sequence of entity 1 (B, L), FASTA

>3O41_1 Mouse monoclonal antibody 101F Fab light chain (chains B, L)
DIVLTQSPASLAVSLGQRATIFCRASQSVDYNGISYMHWFQQKPGQPPKLLIYAASNPES
GIPARFTGSGSGTDFTLNIHPVEEEDAATYYCQQIIEDPWTFGGGTKLEIKRADAAPTVS
IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS
STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (A, H), FASTA

>3O41_2 Mouse monoclonal antibody 101F Fab heavy chain (chains A, H)
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKR
YNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARLYGFTYGFAYWGQGTLVTVSA
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Sequence of entity 3 (C, P), FASTA

>3O41_3 Fusion glycoprotein F1 (chains C, P)
XSTASNKNRGIIKTFSX

Primary citation

Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F. McLellan, J.S., Chen, M., Chang, J.S. et al. J Virol (2010) 84:12236-12244. DOI 10.1128/JVI.01579-10 · PubMed

Other PDB entries of the same protein (UniProt P03420), best resolution first:

29QJ 1.32 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
6OJ7 1.45 Å, Respiratory syncytial virus fusion glycoprotein N-terminal heptad repeat domain+VIQKI…
3KPE 1.47 Å, Solution structure of the respiratory syncytial virus (RSV)six-helix bundle complexed…
9RA5 1.63 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain in complex…
9VWE 2.06 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
7LVW 2.1 Å, Structure of RSV F in Complex with VHH Cl184
6NTX 2.2 Å, Respiratory syncytial virus fusion protein N-terminal heptad repeat domain+VIQKI
8DG9 2.24 Å, Cryo-EM Structure of RSV prefusion F trimer in complex with three MxR Fabs
8PHI 2.29 Å, Crystal structure of prefusion-stabilized RSV F Variant DS-Cav1 in complex with Lonafarnib
5C69 2.3 Å, Crystal Structure of Prefusion-stabilized RSV F variant PR-DM
5EA4 2.3 Å, Crystal Structure of Inhibitor JNJ-49153390 in Complex with Prefusion RSV F Glycoprotein

Browse structure collections

About this viewer

MolViewer shows 3O41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.