3O78: Ca2+ Sensor

The structure of Ca2+ Sensor (Case-12). Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Sept 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Gallus gallus, Aequorea victoria, Homo sapiens
Chains: 2
Atoms: 6,423
Mol. weight: 93.3 kDa
Ligands: CA
Released: 29 Sept 2010

Explore 3O78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O78 contains 36 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	5-22	18
β-strand	28-33	6	1
α-helix	34-36	3
β-strand	38-48	11	1
β-strand	49	1	2
β-strand	54-65	12	1
α-helix	73-75	3
β-strand	77-86	10	1
β-strand	95-105	11	1
α-helix	128-131	4
β-strand	136-146	11	1
β-strand	149-160	12	1
α-helix	161-163	3
β-strand	165-172	8	1
α-helix	181-184	4
α-helix	193-195	3
β-strand	197	1	1
α-helix	200-202	3
α-helix	207-210	4
β-strand	216-224	9	1
β-strand	229-239	11	1
β-strand	242-252	11	1
β-strand	265	1	2
α-helix	272-274	3
α-helix	275-288	14
β-strand	295-296	2	3
α-helix	298-308	11
α-helix	314-322	9
β-strand	332-333	2	3
α-helix	334-342	9
α-helix	347-361	15
β-strand	369	1	4
α-helix	371-380	10
α-helix	387-397	11
β-strand	405	1	4
α-helix	407-414	8

Chain B: 18 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	8-22	15
β-strand	28-33	6	5
α-helix	34-36	3
β-strand	38-48	11	5
β-strand	49	1	6
β-strand	54-65	12	5
α-helix	73-75	3
β-strand	77-86	10	5
β-strand	95-105	11	5
α-helix	128-132	5
β-strand	136-146	11	5
β-strand	149-160	12	5
α-helix	161-163	3
β-strand	165-171	7	5
α-helix	181-184	4
α-helix	193-195	3
β-strand	197	1	5
α-helix	200-202	3
α-helix	207-210	4
β-strand	216-224	9	5
β-strand	229-239	11	5
β-strand	242-252	11	5
β-strand	265	1	6
α-helix	272-274	3
α-helix	275-288	14
β-strand	295-296	2	7
α-helix	298-308	11
α-helix	314-322	9
β-strand	332-333	2	7
α-helix	334-342	9
α-helix	347-361	15
β-strand	369	1	8
α-helix	371-380	10
α-helix	387-397	11
β-strand	405	1	8
α-helix	407-414	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase, smooth muscle,Green fluorescent protein,Green fluorescent…	A, B	protein	415	Gallus gallus, Aequorea victoria, Homo sapiens	P0DP24 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3O78_1 Myosin light chain kinase, smooth muscle,Green fluorescent protein,Green fluorescent protein,Calmodulin-1 (chains A, B)
GPGSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNVEDGSVQLADHY
QQNTPIGDGPVLLPDNHYLSFQSVLSKDPNEKRDHMVLLEFVTAAGITLGMDELYNVDGG
SGGTGSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVP
WPTLVTTLXLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDT
LVNRIELKGIGFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELG
TVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFD
KDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8

Primary citation

The structure of Ca2+ sensor Case16 reveals the mechanism of reaction to low Ca2+ concentrations. Leder, L., Stark, W., Freuler, F. et al. Sensors (Basel) (2010) 10:8143-8160. DOI 10.3390/s100908143 · PubMed

Other PDB entries of the same protein (UniProt P0DP24 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XXF 1.7 Å, 1.7 Angstrom crystal structure of Ca/CaM:RyR2 peptide complex
6SZ5 2.23 Å, Human calmodulin bound to a peptide of human NADPH oxidase 5
3O77 2.35 Å, The structure of Ca2+ Sensor (Case-16)
8KA0 2.35 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7MIR 2.5 Å, Cryo-EM structure of SidJ-SdeA-CaM reaction intermediate complex
6PLM 2.59 Å, Legionella pneumophila SidJ/ Calmodulin 2 complex
5COC 2.67 Å, Fusion protein of human calmodulin and B4 domain of protein A from staphylococcal aureus
6MUD 2.69 Å, Voltage-gated sodium channel NaV1.5 C-terminal domain in complex with Ca2+/Calmodulin
7MIS 2.8 Å, Cryo-EM structure of SidJ-SdeC-CaM reaction intermediate complex
8KA1 2.82 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
8K9Z 2.9 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7PPO 2.91 Å, Structure of SidJ/CaM bound to SdeA in pre-glutamylation state

Browse structure collections

About this viewer

MolViewer shows 3O78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.