4J24: Estrogen Receptor
Estrogen Receptor in complex with proline-flanked LXXLL peptides. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Mar 2013.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 8,245
- Mol. weight
- 118.27 kDa
- Ligands
- EST
- Released
- 13 Mar 2013
Explore 4J24 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4J24 contains 51 α-helices and 12 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-278 | 3 | |
| β-strand | 279 | 1 | 1 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-315 | 25 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 2 |
| β-strand | 360-363 | 4 | 2 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-390 | 18 | |
| α-helix | 394-406 | 13 | |
| α-helix | 423-443 | 21 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-496 | 8 | |
Chain B: 12 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-280 | 5 | |
| β-strand | 283 | 1 | 3 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 4 |
| β-strand | 359 | 1 | 3 |
| β-strand | 360-363 | 4 | 4 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-407 | 14 | |
| α-helix | 422-443 | 22 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-496 | 8 | |
Chain C: 12 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-274 | 10 | |
| α-helix | 276-278 | 3 | |
| β-strand | 279 | 1 | 1 |
| α-helix | 288-289 | 2 | |
| α-helix | 291-315 | 25 | |
| α-helix | 319-321 | 3 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 5 |
| β-strand | 360-363 | 4 | 5 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-407 | 14 | |
| α-helix | 423-443 | 21 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-497 | 9 | |
Chain D: 11 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 265-275 | 11 | |
| α-helix | 276-281 | 6 | |
| α-helix | 288-289 | 2 | |
| α-helix | 291-314 | 24 | |
| α-helix | 324-347 | 24 | |
| β-strand | 353-357 | 5 | 6 |
| β-strand | 360-363 | 4 | 6 |
| α-helix | 364-369 | 6 | |
| α-helix | 373-389 | 17 | |
| α-helix | 394-407 | 14 | |
| α-helix | 424-443 | 20 | |
| α-helix | 448-481 | 34 | |
| α-helix | 489-496 | 8 | |
Chains I, J and K: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-13 | 8 | |
Chain L: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-12 | 7 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Estrogen receptor beta | A, B, C, D | protein | 240 | Homo sapiens | Q92731 (AlphaFold model) |
| 19-mer peptide | I, J, K, L | protein | 19 | | |
Sequence of entity 1 (A, B, C, D), FASTA
>4J24_1 Estrogen receptor beta (chains A, B, C, D)
DALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFV
ELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDML
LATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWV
IAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
Sequence of entity 2 (I, J, K, L), FASTA
>4J24_2 19-mer peptide (chains I, J, K, L)
LTARHPLLLRHLLQNSPSD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| EST | Estradiol | C18 H24 O2 | 4 |
Primary citation
Proline primed helix length as a modulator of the nuclear receptor-coactivator interaction. Fuchs, S., Nguyen, H.D., Phan, T.T. et al. J Am Chem Soc (2013) 135:4364-4371. DOI 10.1021/ja311748r · PubMed
Other PDB entries of the same protein (UniProt Q92731 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3OLL 1.5 Å, Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
- 7XVY 1.54 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with S-DPN
- 1QKM 1.8 Å, Human oestrogen receptor beta ligand-binding domain in complex with partial agonist…
- 7XWQ 1.89 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 7XWP 1.92 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 2YJD 1.93 Å, Stapled peptide bound to Estrogen Receptor Beta
- 3OMQ 1.97 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
- 9ECF 2.0 Å, Crystal structure of the hERbeta LBD complexed with androstenediol and SRC 2-2 peptide…
- 1YYE 2.03 Å, Crystal structure of estrogen receptor beta complexed with way-202196
- 3OMP 2.05 Å, Fragment-Based Design of novel Estrogen Receptor Ligands
- 7XVZ 2.08 Å, Human Estrogen Receptor beta Ligand-binding Domain in Complex with…
- 2NV7 2.1 Å, Crystal Structure of Estrogen Receptor Beta Complexed with WAY-555
Browse structure collections
About this viewer
MolViewer shows 4J24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.