Crystal Structure of motif N of Saccharomyces cerevisiae Dbf4. Determined by X-ray diffraction at 2.4 Å resolution. Released 7 Sept 2011.
Explore 3OQ4 in 3D Show helices and sheets RCSB PDB PDBe
3OQ4 contains 24 α-helices and 24 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 125-128 | 4 | 1 |
| α-helix | 138-157 | 20 | |
| β-strand | 161-163 | 3 | 1 |
| β-strand | 172-175 | 4 | 1 |
| α-helix | 179-184 | 6 | |
| α-helix | 190-196 | 7 | |
| β-strand | 200-203 | 4 | 1 |
| α-helix | 204-213 | 10 | |
| α-helix | 218-221 | 4 | |
| α-helix | 233-241 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 125-128 | 4 | 2 |
| β-strand | 134-135 | 2 | 1 |
| α-helix | 138-156 | 19 | |
| β-strand | 161-163 | 3 | 2 |
| β-strand | 172-175 | 4 | 2 |
| α-helix | 179-184 | 6 | |
| α-helix | 190-196 | 7 | |
| β-strand | 200-203 | 4 | 2 |
| α-helix | 204-213 | 10 | |
| α-helix | 218-222 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 125-128 | 4 | 3 |
| β-strand | 134-135 | 2 | 2 |
| α-helix | 138-158 | 21 | |
| β-strand | 161-163 | 3 | 3 |
| β-strand | 172-175 | 4 | 3 |
| α-helix | 179-184 | 6 | |
| α-helix | 190-196 | 7 | |
| β-strand | 200-203 | 4 | 3 |
| α-helix | 204-213 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 125-128 | 4 | 4 |
| β-strand | 134-135 | 2 | 3 |
| α-helix | 138-157 | 20 | |
| β-strand | 161-163 | 3 | 4 |
| β-strand | 172-175 | 4 | 4 |
| α-helix | 179-184 | 6 | |
| α-helix | 190-196 | 7 | |
| β-strand | 200-203 | 4 | 4 |
| α-helix | 204-213 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 122-124 | 3 | |
| β-strand | 125-128 | 4 | 5 |
| β-strand | 134-135 | 2 | 4 |
| α-helix | 138-157 | 20 | |
| β-strand | 161-162 | 2 | 5 |
| β-strand | 172-175 | 4 | 5 |
| α-helix | 182-184 | 3 | |
| α-helix | 190-196 | 7 | |
| β-strand | 200-203 | 4 | 5 |
| α-helix | 209-214 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DBF4 | A, B, C, D, E | protein | 134 | Saccharomyces cerevisiae | P32325 (AlphaFold model) |
>3OQ4_1 DBF4 (chains A, B, C, D, E) GSHMKRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITR RSVENIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSN LLHNEKLYGPTDRD
Crystal Structure of Saccharomyces cerevisiae Dbf4-motif N. Matthews, L.A., Jones, D.R., Prasad, A.A. et al. To be published.
Other PDB entries of the same protein (UniProt P32325 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3OQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.