3P2D: Beta-arrestin-2

Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding between two non-visual subtypes. Determined by X-ray diffraction at 3.0 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Bos taurus
Chains: 2
Atoms: 5,611
Mol. weight: 88.47 kDa
Released: 26 Jan 2011

Explore 3P2D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P2D contains 12 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	1
β-strand	19-23	5	1
β-strand	27-30	4	2
β-strand	35	1	2
β-strand	38-44	7	1
β-strand	53-64	12	3
β-strand	76-83	8	3
β-strand	86-88	3	3
α-helix	100-108	9
β-strand	113-118	6	1
β-strand	128-131	4	3
α-helix	138-140	3
β-strand	141-152	12	3
α-helix	161-163	3
β-strand	165-169	5	3
β-strand	170-173	4	2
β-strand	186-191	6	4
β-strand	197-203	7	4
β-strand	208-210	3	5
β-strand	215-223	9	4
β-strand	229-242	14	6
β-strand	248-258	11	6
β-strand	263	1	6
β-strand	269-275	7	4
α-helix	279-281	3
β-strand	288-290	3	3
β-strand	301	1	3
α-helix	302-303	2
α-helix	314-316	3
β-strand	318-330	13	6
β-strand	336-342	7	6
β-strand	343-345	3	5
α-helix	346-347	2
β-strand	387-390	4	1

Chain B: 5 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	7
β-strand	20-23	4	7
β-strand	27-30	4	8
β-strand	35	1	8
β-strand	38-43	6	7
β-strand	53-64	12	9
β-strand	76-88	13	9
α-helix	100-107	8
β-strand	113	1	7
β-strand	116-118	3	7
α-helix	125-127	3
β-strand	128-131	4	9
β-strand	141-152	12	9
β-strand	165-169	5	9
β-strand	170-173	4	8
β-strand	186-190	5	10
β-strand	198-203	6	10
β-strand	208-210	3	11
α-helix	213-214	2
β-strand	215-223	9	10
β-strand	229-242	14	12
β-strand	248-257	10	12
β-strand	263	1	12
β-strand	267-275	9	10
α-helix	279-281	3
β-strand	288-290	3	9
β-strand	301	1	9
α-helix	302-303	2
β-strand	318-330	13	12
β-strand	335-342	8	12
β-strand	343-345	3	11
β-strand	388-390	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B	protein	393	Bos taurus	P32120 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3P2D_1 Beta-arrestin-2 (chains A, B)
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AAPETDAPVDTNLIEFETNYATDDDIVFEDFAR

Primary citation

Crystal Structure of Arrestin-3 Reveals the Basis of the Difference in Receptor Binding Between Two Non-visual Subtypes. Zhan, X., Gimenez, L.E., Gurevich, V.V. et al. J Mol Biol (2011) 406:467-478. DOI 10.1016/j.jmb.2010.12.034 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 3P2D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.