8I10: Beta-arrestin2

Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human Vasopressin V2 receptor, V2R (Local refine). Determined by electron microscopy at 3.96 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 3.96 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 12
Atoms: 13,196
Mol. weight: 299.15 kDa
Released: 17 May 2023

Explore 8I10 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I10 contains 43 α-helices and 152 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	1
β-strand	19-23	5	1
β-strand	27-29	3	2
β-strand	30	1	3
β-strand	35	1	3
β-strand	40-44	5	1
β-strand	53-61	9	4
β-strand	79-88	10	4
α-helix	90-91	2
α-helix	100-109	10
β-strand	113-116	4	1
β-strand	128-130	3	5
α-helix	131-133	3
β-strand	144-152	9	4
α-helix	158-159	2
β-strand	164-169	6	4
β-strand	170-172	3	2
α-helix	181-183	3
β-strand	184-190	7	6
β-strand	197-204	8	6
β-strand	208-209	2	7
α-helix	213-214	2
β-strand	215-224	10	6
β-strand	229-240	12	8
β-strand	243	1	9
β-strand	247	1	9
β-strand	250-259	10	8
β-strand	263	1	8
β-strand	267-275	9	6
α-helix	280-282	3
α-helix	288	1
β-strand	289-291	3	5
α-helix	292-293	2
α-helix	300	1
β-strand	301	1	5
α-helix	302-305	4
β-strand	320-330	11	8
β-strand	336-342	7	8
β-strand	343-344	2	7

Chain B: 9 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	10
β-strand	19-23	5	10
β-strand	27-29	3	11
β-strand	30	1	12
β-strand	35	1	12
β-strand	40-44	5	10
β-strand	53-63	11	13
β-strand	78-82	5	13
β-strand	85-88	4	13
α-helix	100-109	10
α-helix	110-112	3
β-strand	113-116	4	10
β-strand	128-130	3	13
α-helix	131-133	3
β-strand	142-152	11	13
α-helix	161-163	3
β-strand	164-167	4	13
β-strand	170-172	3	11
α-helix	181-183	3
β-strand	184-190	7	14
β-strand	197-204	8	14
β-strand	208-209	2	15
α-helix	213-214	2
β-strand	215-224	10	14
β-strand	229-240	12	16
β-strand	250-259	10	16
β-strand	263	1	16
β-strand	267-275	9	14
α-helix	280-282	3
β-strand	289-291	3	13
α-helix	300	1
β-strand	301	1	13
α-helix	302-303	2
β-strand	320-330	11	16
β-strand	336-342	7	16
β-strand	343-344	2	15

Chain C: 12 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	10-13	4	17
β-strand	19-23	5	17
β-strand	27-29	3	18
β-strand	30	1	19
β-strand	35	1	19
β-strand	40-44	5	17
β-strand	53-62	10	20
β-strand	78-88	11	20
α-helix	90-91	2
α-helix	100-109	10
β-strand	113-116	4	17
β-strand	128-130	3	21
α-helix	131-133	3
β-strand	144-152	9	20
α-helix	158-159	2
β-strand	164-169	6	20
β-strand	170-172	3	18
α-helix	181-183	3
β-strand	184-190	7	22
β-strand	197-203	7	22
β-strand	208-209	2	23
α-helix	213-214	2
β-strand	215-224	10	22
β-strand	229-242	14	24
β-strand	248-259	12	24
β-strand	263	1	24
β-strand	267-275	9	22
α-helix	280-282	3
α-helix	288	1
β-strand	289-291	3	21
α-helix	292-293	2
α-helix	300	1
β-strand	301	1	21
α-helix	302-305	4
β-strand	318-330	13	24
β-strand	336-342	7	24
β-strand	343-344	2	23
α-helix	346-349	4

Chain D: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	25
β-strand	13-15	3	26
β-strand	21-28	8	25
β-strand	35-42	8	26
α-helix	47-48	2
β-strand	49-54	6	26
β-strand	61-63	3	26
β-strand	71-76	6	25
β-strand	81-86	6	25
α-helix	91-93	3
β-strand	95-103	9	26
β-strand	112-113	2	26
β-strand	117-121	5	26

Chain E: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	27
β-strand	11-12	2	28
β-strand	20-26	7	27
β-strand	34-39	6	28
β-strand	46-50	5	28
β-strand	54-55	2	28
α-helix	56	1
β-strand	63-68	6	27
β-strand	71-76	6	27
β-strand	86-91	6	28
α-helix	97	1
β-strand	98-99	2	28
β-strand	103-105	3	28

Chains G, U and V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-362	2	1

Chain H: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	29
β-strand	13-14	2	30
β-strand	21-28	8	29
β-strand	35-42	8	30
α-helix	47-48	2
β-strand	49-54	6	30
β-strand	61-63	3	30
β-strand	71-76	6	29
β-strand	81-86	6	29
α-helix	91-93	3
β-strand	95-103	9	30
β-strand	112-113	2	30
β-strand	117-120	4	30

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	31
β-strand	11-14	4	32
β-strand	20-26	7	31
β-strand	34-39	6	32
β-strand	45-50	6	32
β-strand	54-55	2	32
α-helix	56	1
β-strand	63-68	6	31
β-strand	71-76	6	31
β-strand	86-91	6	32
α-helix	97	1
β-strand	98-99	2	32
β-strand	103-107	5	32

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B, C	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	D, H, M	protein	237	Mus musculus
Fab30 Light Chain	E, L, N	protein	215	Mus musculus
Vasopressin V2 receptor	G, U, V	protein	29	Homo sapiens	P30518 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8I10_1 Beta-arrestin-2 (chains A, B, C)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (D, H, M), FASTA

>8I10_2 Fab30 Heavy Chain (chains D, H, M)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (E, L, N), FASTA

>8I10_3 Fab30 Light Chain (chains E, L, N)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, U, V), FASTA

>8I10_4 Vasopressin V2 receptor (chains G, U, V)
ARGRTPPSLGPQDESCTTASSSLAKDTSS

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8I0Z 4.33 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8I10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.