8I0Z: Beta-arrestin2

Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human C5a anaphylatoxin chemotactic receptor 1, C5aR1 (Local refine). Determined by electron microscopy at 4.33 Å resolution. Released 17 May 2023.

Method: Electron microscopy
Resolution: 4.33 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 12
Atoms: 13,163
Mol. weight: 296.59 kDa
Released: 17 May 2023

Explore 8I0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I0Z contains 47 α-helices and 159 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	20-23	4	1
β-strand	27-29	3	2
α-helix	36-37	2
β-strand	38	1	3
β-strand	41-43	3	1
β-strand	53-63	11	4
β-strand	74	1	5
β-strand	79-88	10	4
α-helix	97-99	3
α-helix	100-109	10
β-strand	113-115	3	1
β-strand	118	1	3
β-strand	128-130	3	4
α-helix	131-133	3
α-helix	140	1
β-strand	142-152	11	4
β-strand	164-169	6	4
β-strand	170-172	3	2
α-helix	181-183	3
β-strand	184-190	7	6
β-strand	197-204	8	6
β-strand	208-209	2	7
β-strand	215-223	9	6
β-strand	229-242	14	8
β-strand	248-259	12	8
β-strand	263	1	8
β-strand	267-275	9	6
α-helix	280-282	3
β-strand	289-291	3	4
α-helix	292-293	2
α-helix	300	1
β-strand	301	1	4
α-helix	302-303	2
β-strand	318-330	13	8
β-strand	336-342	7	8
β-strand	343-344	2	7
α-helix	346-349	4

Chain B: 12 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	9
β-strand	20-23	4	9
β-strand	27-29	3	10
α-helix	36-37	2
β-strand	38	1	11
β-strand	41-43	3	9
β-strand	53-63	11	12
β-strand	74	1	8
β-strand	79-88	10	12
α-helix	97-99	3
α-helix	100-109	10
β-strand	113-115	3	9
β-strand	118	1	11
β-strand	128-130	3	12
α-helix	131-133	3
β-strand	142-152	11	12
α-helix	158-159	2
α-helix	161-163	3
β-strand	164-169	6	12
β-strand	170-172	3	10
α-helix	181-183	3
β-strand	184-190	7	13
β-strand	197-204	8	13
β-strand	208-209	2	14
β-strand	215-224	10	13
β-strand	229-242	14	15
β-strand	247-259	13	15
β-strand	263	1	15
β-strand	267-275	9	13
α-helix	280-282	3
β-strand	289-291	3	12
α-helix	292-293	2
α-helix	300	1
β-strand	301	1	12
α-helix	302-305	4
β-strand	318-330	13	15
β-strand	336-342	7	15
β-strand	343-344	2	14
α-helix	346-349	4

Chain C: 10 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	16
β-strand	20-23	4	16
β-strand	27-29	3	17
α-helix	36-37	2
β-strand	38	1	18
β-strand	41-43	3	16
β-strand	53-63	11	19
β-strand	74-77	4	15
β-strand	78-88	11	19
α-helix	100-109	10
β-strand	113-115	3	16
β-strand	118	1	18
β-strand	128-130	3	19
α-helix	131-133	3
β-strand	142-152	11	19
α-helix	158-159	2
β-strand	164-169	6	19
β-strand	170-172	3	17
α-helix	181-183	3
β-strand	184-187	4	20
β-strand	190	1	21
β-strand	197	1	21
β-strand	200-204	5	20
β-strand	208-209	2	22
β-strand	215-223	9	20
β-strand	224	1	21
β-strand	229-243	15	5
β-strand	247-259	13	5
β-strand	263	1	5
β-strand	267-275	9	20
α-helix	280-282	3
β-strand	289-291	3	19
α-helix	292-293	2
α-helix	300	1
β-strand	301	1	19
α-helix	302-305	4
β-strand	317-330	14	5
β-strand	336-342	7	5
β-strand	343-344	2	22
α-helix	346-349	4

Chain D: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	23
β-strand	14-15	2	24
β-strand	23-28	6	23
α-helix	32-34	3
β-strand	35-42	8	25
β-strand	50-55	6	25
β-strand	61-63	3	25
α-helix	65-67	3
β-strand	71-76	6	23
β-strand	81-86	6	23
α-helix	91-93	3
β-strand	95-103	9	25
β-strand	113	1	25
β-strand	117-119	3	25
β-strand	120-121	2	24

Chains E, L and N: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	26
β-strand	20-26	7	26
β-strand	34-39	6	27
β-strand	46-50	5	27
β-strand	54-55	2	27
α-helix	56	1
β-strand	63-68	6	26
β-strand	71-76	6	26
β-strand	86-91	6	27
α-helix	97	1
β-strand	98-99	2	27

Chains G and U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	337-339	3	1

Chain H: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	28
β-strand	14	1	29
β-strand	20	1	30
β-strand	23-28	6	28
α-helix	32-34	3
β-strand	35	1	31
β-strand	36-42	7	32
β-strand	43	1	33
β-strand	46	1	33
β-strand	50-55	6	32
β-strand	60-63	4	32
α-helix	65-67	3
β-strand	71-76	6	28
β-strand	81-86	6	28
β-strand	87	1	30
α-helix	91-93	3
β-strand	95-100	6	32
β-strand	103	1	31
β-strand	113	1	32
β-strand	117-119	3	32
β-strand	120	1	29

Chain M: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	36
β-strand	14-15	2	37
β-strand	23-26	4	38
β-strand	28	1	36
α-helix	32-34	3
β-strand	35	1	39
β-strand	36-42	7	40
β-strand	48-55	8	40
β-strand	60-63	4	40
α-helix	65-67	3
β-strand	71-76	6	38
β-strand	81-86	6	38
β-strand	95-100	6	40
β-strand	103	1	39
β-strand	113	1	40
β-strand	117-119	3	40
β-strand	120-121	2	37

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-2	A, B, C	protein	420	Bos taurus	P32120 (AlphaFold model)
Fab30 Heavy Chain	D, H, M	protein	237	Mus musculus
Fab30 Light Chain	E, L, N	protein	215	Mus musculus
C5a anaphylatoxin chemotactic receptor 1	G, U, V	protein	20	Homo sapiens	P21730 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8I0Z_1 Beta-arrestin-2 (chains A, B, C)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDCDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS
AATHPPTLLPSAVPETDAPVDTNLIEFETNYATDDDIVFEDFARLRLKGLKDEDYDDQFC

Sequence of entity 2 (D, H, M), FASTA

>8I0Z_2 Fab30 Heavy Chain (chains D, H, M)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHH

Sequence of entity 3 (E, L, N), FASTA

>8I0Z_3 Fab30 Light Chain (chains E, L, N)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (G, U, V), FASTA

>8I0Z_4 C5a anaphylatoxin chemotactic receptor 1 (chains G, U, V)
ESKSFTRSTVDTMAQKTQAV

Primary citation

Structural snapshots uncover a key phosphorylation motif in GPCRs driving beta-arrestin activation. Maharana, J., Sarma, P., Yadav, M.K. et al. Mol Cell (2023) 83:2091-2107.e7. DOI 10.1016/j.molcel.2023.04.025 · PubMed

Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TV1 2.4 Å, active arrestin-3 with inositol hexakisphosphate
9KY2 2.78 Å, Structure of beta-arrestin2 in complex with mouse C5aR1pp
8J8R 2.9 Å, Structure of beta-arrestin2 in complex with M2Rpp
3P2D 3.0 Å, Crystal structure of arrestin-3 reveals the basis of the difference in receptor binding…
8J8V 3.22 Å, Structure of beta-arrestin2 in complex with D6Rpp (Local Refine)
8VJ9 3.3 Å, CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant…
8GO9 3.35 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIL 3.8 Å, Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without…
8I10 3.96 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8TIN 4.0 Å, Human ACKR3 phosphorylated by GRK2 in complex with Arrestin3 reconstructed without…
8GOC 4.18 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…
8GOO 4.4 Å, Structure of beta-arrestin2 in complex with a phosphopeptide corresponding to the human…

Browse structure collections

About this viewer

MolViewer shows 8I0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.