active arrestin-3 with inositol hexakisphosphate. Determined by X-ray diffraction at 2.4 Å resolution. Released 22 Nov 2017.
Explore 5TV1 in 3D Show helices and sheets RCSB PDB PDBe
5TV1 contains 11 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-13 | 4 | 1 |
| β-strand | 19-23 | 5 | 1 |
| β-strand | 27-29 | 3 | 2 |
| β-strand | 30 | 1 | 3 |
| β-strand | 35 | 1 | 3 |
| β-strand | 38-44 | 7 | 1 |
| α-helix | 46-49 | 4 | |
| β-strand | 53-64 | 12 | 4 |
| α-helix | 67-72 | 6 | |
| β-strand | 76-88 | 13 | 4 |
| α-helix | 100-109 | 10 | |
| β-strand | 113-118 | 6 | 1 |
| α-helix | 125-127 | 3 | |
| β-strand | 128-130 | 3 | 4 |
| α-helix | 131-133 | 3 | |
| α-helix | 139-140 | 2 | |
| β-strand | 142-152 | 11 | 4 |
| β-strand | 165-169 | 5 | 4 |
| β-strand | 170-172 | 3 | 2 |
| α-helix | 181-183 | 3 | |
| β-strand | 184-190 | 7 | 5 |
| β-strand | 197-204 | 8 | 5 |
| β-strand | 208-210 | 3 | 6 |
| α-helix | 213-214 | 2 | |
| β-strand | 215-224 | 10 | 5 |
| β-strand | 229-243 | 15 | 7 |
| β-strand | 247-259 | 13 | 7 |
| β-strand | 263 | 1 | 7 |
| β-strand | 267-275 | 9 | 5 |
| α-helix | 279-281 | 3 | |
| β-strand | 289-291 | 3 | 4 |
| β-strand | 301 | 1 | 4 |
| α-helix | 302-305 | 4 | |
| β-strand | 317-330 | 14 | 7 |
| β-strand | 336-342 | 7 | 7 |
| β-strand | 343-345 | 3 | 6 |
| α-helix | 346-348 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-arrestin-2 | A | protein | 393 | Bos taurus | P32120 (AlphaFold model) |
>5TV1_1 Beta-arrestin-2 (chains A) MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC AFRYGREDLDVLGLSFRKDLFIANYQAFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTI PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA DICLFSTAQYKCPVAQVEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTN LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIALPRPQS AVPETDAPVDTNLIEFETNYATDDDIVFEDFAR
| ID | Name | Formula | Copies |
|---|---|---|---|
| IHP | Inositol hexakisphosphate | C6 H18 O24 P6 | 2 |
Water and common crystallization additives (GOL) are not listed.
Structural basis of arrestin-3 activation and signaling. Chen, Q., Perry, N.A., Vishnivetskiy, S.A. et al. Nat Commun (2017) 8:1427-1427. DOI 10.1038/s41467-017-01218-8 · PubMed
Other PDB entries of the same protein (UniProt P32120 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TV1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.