3P7J: Drosophila HP1a chromo shadow domain

Drosophila HP1a chromo shadow domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Feb 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 983
Mol. weight: 20.16 kDa
Released: 2 Feb 2011

Explore 3P7J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P7J contains 6 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	147-148	2
β-strand	149-158	10	1
β-strand	161-168	8	1
β-strand	175-178	4	1
α-helix	179-185	7
α-helix	187-196	10

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	142-145	4
β-strand	149-158	10	2
β-strand	161-168	8	2
β-strand	175-178	4	2
α-helix	179-185	7
α-helix	187-200	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterochromatin protein 1	A, B	protein	87	Drosophila melanogaster	P05205 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3P7J_1 Heterochromatin protein 1 (chains A, B)
MKKHHHHHHEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSV
ANEKIPRMVIHFYEERLSWYSDNEDKK

Primary citation

The HP1a Disordered C Terminus and Chromo Shadow Domain Cooperate to Select Target Peptide Partners. Mendez, D.L., Kim, D., Chruszcz, M. et al. Chembiochem (2011) 12:1084-1096. DOI 10.1002/cbic.201000598 · PubMed

Other PDB entries of the same protein (UniProt P05205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AT0 1.28 Å, Chromodomain HP1 with a p-nitro-L-phenylalanine mutation at position 24 bound to histone…
6MHA 1.5 Å, dHP1 Chromodomain Y24W variant bound to histone H3 peptide containing trimethyllysine
6ASZ 1.52 Å, Chromodomain HP1 with Y24F mutation bound to histone H3 peptide containing trimethyl…
1Q3L 1.64 Å, Chromodomain Of HP1 Complexed With Histone H3 Tail Containing monomethyllysine 9.
1KNA 2.1 Å, Chromo domain of HP1 complexed with histone H3 tail containing dimethyllysine 9.
1KNE 2.4 Å, Chromo domain of HP1 complexed with histone H3 tail containing trimethyllysine 9

Browse structure collections

About this viewer

MolViewer shows 3P7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.