3PD7: Sixth BRCT Domain of Human TopBP1

Crystal Structure of the Sixth BRCT Domain of Human TopBP1. Determined by X-ray diffraction at 1.26 Å resolution. Released 8 Dec 2010.

Method: X-ray diffraction
Resolution: 1.26 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,042
Mol. weight: 24.43 kDa
Released: 8 Dec 2010

Explore 3PD7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PD7 contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	909-912	4	1
α-helix	914-919	6
α-helix	920-929	10
β-strand	933-935	3	1
β-strand	944-946	3	1
α-helix	956-963	8
β-strand	967-969	3	1
α-helix	971-980	10
α-helix	986-988	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA topoisomerase 2-binding protein 1	A, B	protein	107	Homo sapiens	Q92547 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PD7_1 DNA topoisomerase 2-binding protein 1 (chains A, B)
GHMEAQSEKEEAPKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRRSFDETVTHFIYQG
RPNDTNREYKSVKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNGS

Primary citation

Crystal Structure of the Sixth BRCT Domain of Human TopBP1. Lee, J., Xu, C., Cui, G. et al. To be published.

Other PDB entries of the same protein (UniProt Q92547 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JVE 1.34 Å, Crystal Structure of the Sixth BRCT Domain of TopBP1
9MAT 1.65 Å, TopBP1 BRCT 7-8 Domain
7CMZ 1.7 Å, Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8
3UEN 1.9 Å, Crystal structure of TopBP1 BRCT4/5 domains
3AL2 2.0 Å, Crystal Structure of TopBP1 BRCT7/8
3AL3 2.15 Å, Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex
3OLC 2.4 Å, Crystal structure of the N-terminal region of TopBP1
9MAW 2.45 Å, Crystal structure of TOPBP1BRCT7-8 domain in complex with 1-Adamantaneacetic acid
2XNK 2.6 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…
3UEO 2.6 Å, Crystal structure of TopBP1 BRCT4/5 domains in complex with a phospho-peptide
2XNH 2.8 Å, Structure and function of the Rad9-binding region of the DNA damage checkpoint adaptor…
6RML 2.81 Å, Crystal structure of TOPBP1 BRCT0,1,2 in complex with a 53BP1 phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 3PD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.