Structure of ENR G93A mutant-NAD+-Triclosan complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 20 Apr 2011.
Explore 3PJD in 3D Show helices and sheets RCSB PDB PDBe
3PJD contains 36 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| α-helix | 20-30 | 11 | |
| β-strand | 33-39 | 7 | 1 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-81 | 14 | |
| β-strand | 85-90 | 6 | 1 |
| α-helix | 97-99 | 3 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-145 | 11 | 1 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 1 |
| α-helix | 197-199 | 3 | |
| α-helix | 204-208 | 5 | |
| α-helix | 210-213 | 4 | |
| α-helix | 222-233 | 12 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 1 |
| α-helix | 251-253 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 2 |
| α-helix | 20-30 | 11 | |
| α-helix | 33 | 1 | |
| β-strand | 34-39 | 6 | 2 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 68-78 | 11 | |
| β-strand | 85 | 1 | 3 |
| β-strand | 88-90 | 3 | 2 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135 | 1 | 3 |
| α-helix | 136 | 1 | |
| β-strand | 139-145 | 7 | 2 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| β-strand | 182-189 | 8 | 2 |
| α-helix | 196-199 | 4 | |
| α-helix | 204-213 | 10 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 2 |
| α-helix | 251-253 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl-[acyl-carrier-protein] reductase [NADH] | A, B | protein | 270 | Escherichia coli | P0AEK4 (AlphaFold model) |
>3PJD_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B) MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIAFAPGDQLDGDYVNAVTREGFKIAHDIS SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI SGEVVHVDGGFSIAAMNELELKLEHHHHHH
Structural basis of triclosan resistance. Jiten Singh, N., Shin, D.G., Lee, H.M. et al. J Struct Biol (2011) 174:173-179. DOI 10.1016/j.jsb.2010.11.008 · PubMed
Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3PJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.