3PKN: MLLE domain of poly(A) binding protein

Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif of La-related protein 4 (LARP4). Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Jan 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 743
Mol. weight: 11.19 kDa
Released: 12 Jan 2011

Explore 3PKN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PKN contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	547-552	6
α-helix	555-557	3
α-helix	558-573	16
α-helix	578-585	8
α-helix	590-598	9
α-helix	600-621	22

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyadenylate-binding protein 1	A	protein	88	Homo sapiens	P11940 (AlphaFold model)
La-related protein 4	B	protein	14		Q71RC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PKN_1 Polyadenylate-binding protein 1 (chains A)
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLE
SPESLRSKVDEAVAVLQAHQAKEAAQKA

Sequence of entity 2 (B), FASTA

>3PKN_2 La-related protein 4 (chains B)
TGLNPNAKVWQEIA

Primary citation

La-Related Protein 4 Binds Poly(A), Interacts with the Poly(A)-Binding Protein MLLE Domain via a Variant PAM2w Motif, and Can Promote mRNA Stability. Yang, R., Gaidamakov, S.A., Xie, J. et al. Mol Cell Biol (2011) 31:542-556. DOI 10.1128/MCB.01162-10 · PubMed

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3KTR 1.7 Å, Structural basis of ataxin-2 recognition by poly(A)-binding protein
3PTH 1.7 Å, The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
7BN3 1.93 Å, Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from…
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
4F02 2.0 Å, Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and…

Browse structure collections

About this viewer

MolViewer shows 3PKN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.