3PTH: The PABC1 MLLE domain

The PABC1 MLLE domain bound to the variant PAM2 motif of LARP4B. Determined by X-ray diffraction at 1.7 Å resolution. Released 21 Dec 2011.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 769
Mol. weight: 10.58 kDa
Released: 21 Dec 2011

Explore 3PTH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PTH contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	547-552	6
α-helix	555-571	17
α-helix	578-585	8
α-helix	590-598	9
α-helix	600-615	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	60-62	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyadenylate-binding protein 1	A	protein	82	Homo sapiens	P11940 (AlphaFold model)
La-related protein 4B	B	protein	15	Homo sapiens	Q92615 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3PTH_1 Polyadenylate-binding protein 1 (chains A)
GAMEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLES
PESLRSKVDEAVAVLQAHQAKE

Sequence of entity 2 (B), FASTA

>3PTH_2 La-related protein 4B (chains B)
ELNPNAEVWGAPVLH

Primary citation

LARP4B binds to the PABC1 MLLE domain via a variant PAM2 motif. Grimm, C., Pelz, J.P. To be published.

Other PDB entries of the same protein (UniProt P11940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KUJ 1.4 Å, Crystal structure of C-terminal domain of PABPC1 in complex with binding region of eRF3a
3KUS 1.4 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
3KUT 1.5 Å, Crystal structure of the MLLE domain of poly(A)-binding protein in complex with the…
3KTR 1.7 Å, Structural basis of ataxin-2 recognition by poly(A)-binding protein
3PKN 1.8 Å, Crystal structure of MLLE domain of poly(A) binding protein in complex with PAM2 motif…
4F25 1.9 Å, Crystal structure of the second RRM domain of human PABPC1 at pH 6.0
5DX1 1.93 Å, Crystal structure of CARM1, sinefungin, and PABP1 peptide (R455)
7BN3 1.93 Å, Crystal structure of C-terminal domain of PABPC1 in complex with Nucleoprotein from…
5DX8 1.94 Å, Crystal structure of CARM1, sinefungin, and methylated PABP1 peptide (R455)
4F02 2.0 Å, Crystal structure of the PABP-binding site of eIF4G in complex with RRM1-2 of PABP and…

Browse structure collections

About this viewer

MolViewer shows 3PTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.