3PUJ: MUNC18-1 and SYNTAXIN4 N-Peptide complex

Crystal structure of the MUNC18-1 and SYNTAXIN4 N-Peptide complex. Determined by X-ray diffraction at 3.31 Å resolution. Released 19 Jan 2011.

Method: X-ray diffraction
Resolution: 3.31 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 4
Atoms: 8,638
Mol. weight: 138.02 kDa
Released: 19 Jan 2011

Explore 3PUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PUJ contains 70 α-helices and 49 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
α-helix	20-22	3
β-strand	29-33	5	1
α-helix	35-44	10
α-helix	47-50	4
β-strand	55-60	6	1
β-strand	68	1	2
β-strand	72-77	6	1
α-helix	81-89	9
β-strand	99	1	2
β-strand	102-106	5	1
α-helix	109-111	3
α-helix	112-119	8
α-helix	123-126	4
β-strand	127-132	6	1
β-strand	138-141	4	3
β-strand	144-146	3	3
α-helix	150-157	8
α-helix	160-164	5
α-helix	165-182	18
α-helix	187	1
β-strand	188-191	4	3
α-helix	196-215	20
α-helix	224-227	4
β-strand	229-234	6	3
α-helix	235-237	3
α-helix	241-243	3
β-strand	248	1	4
α-helix	249-256	8
β-strand	260	1	5
β-strand	263-266	4	5
β-strand	277-280	4	5
α-helix	286-291	6
β-strand	295	1	4
α-helix	298-310	13
α-helix	311-313	3
α-helix	327-332	6
α-helix	334-357	24
α-helix	361-374	14
β-strand	376	1	6
α-helix	381	1
β-strand	382	1	6
α-helix	383	1
α-helix	386-395	10
α-helix	401-414	14
β-strand	418	1	7
α-helix	420-430	11
α-helix	434-442	9
α-helix	443-446	4
β-strand	451	1	7
α-helix	481-490	10
β-strand	501	1	3
β-strand	536-542	7	3
β-strand	545-546	2	8
α-helix	547-560	14
β-strand	564-569	6	3
β-strand	572-573	2	8
α-helix	575-583	9

Chain B: 34 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	6-13	8
α-helix	14-20	7
α-helix	21-22	2
β-strand	29-33	5	9
α-helix	35-44	10
α-helix	47-52	6
β-strand	55-60	6	9
β-strand	68	1	10
β-strand	73-77	5	9
α-helix	81-92	12
β-strand	99	1	10
β-strand	102-106	5	9
α-helix	109-111	3
α-helix	112-119	8
α-helix	123-126	4
β-strand	127-132	6	9
β-strand	138-139	2	11
β-strand	144-146	3	11
α-helix	154-157	4
α-helix	162-164	3
α-helix	165-182	18
α-helix	187	1
β-strand	188-191	4	11
α-helix	196-215	20
α-helix	223-227	5
β-strand	229-234	6	11
α-helix	235-237	3
α-helix	241-243	3
β-strand	248	1	12
α-helix	249-256	8
β-strand	260	1	13
β-strand	263-266	4	13
β-strand	277-280	4	13
α-helix	286-291	6
β-strand	295	1	12
α-helix	299-313	15
α-helix	324-358	35
α-helix	363-374	12
β-strand	376	1	14
α-helix	381	1
β-strand	382	1	14
α-helix	383	1
α-helix	386-395	10
α-helix	401-415	15
α-helix	420-428	9
α-helix	434-442	9
α-helix	443-446	4
α-helix	481-490	10
α-helix	500	1
β-strand	501	1	11
α-helix	502-503	2
β-strand	536-542	7	11
β-strand	545-546	2	15
α-helix	547-560	14
β-strand	564-569	6	11
β-strand	572-573	2	15
α-helix	575-582	8

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-9	5

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-binding protein 1	A, B	protein	594	Rattus norvegicus	P61765 (AlphaFold model)
Syntaxin-4 N-terminal peptide	C, D	protein	10	Mus musculus	P70452 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PUJ_1 Syntaxin-binding protein 1 (chains A, B)
MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVED
INKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVK
SRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLC
ATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPS
SPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVS
QEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQG
TVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITE
ENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTP
IIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIF
ILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS

Sequence of entity 2 (C, D), FASTA

>3PUJ_2 Syntaxin-4 N-terminal peptide (chains C, D)
MRDRTHELRQ

Primary citation

Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. Hu, S.-H., Christie, M.P., Saez, N.J. et al. Proc Natl Acad Sci U S A (2011) 108:1040-1045. DOI 10.1073/pnas.0914906108 · PubMed

Other PDB entries of the same protein (UniProt P61765 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex
4JEU 3.2 Å, Crystal Structure of Munc18a and Syntaxin1 with native N-terminus complex
7XSJ 3.2 Å, The structure of the Mint1/Munc18-1/syntaxin-1 complex
6LPC 3.4 Å, Crystal Structure of rat Munc18-1 with K332E/K333E mutation
7UDB 3.5 Å, Cryo-EM structure of a synaptobrevin-Munc18-1-syntaxin-1 complex class 2
7UDC 3.7 Å, cryo-EM structures of a synaptobrevin-Munc18-1-syntaxin-1 complex class1

Browse structure collections

About this viewer

MolViewer shows 3PUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.