3Q7O: BamB from the BAM complex in spacegroup P213

The crystal structure of BamB from the BAM complex in spacegroup P213. Determined by X-ray diffraction at 2.09 Å resolution. Released 9 Feb 2011.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Escherichia coli
Chains: 1
Atoms: 2,820
Mol. weight: 40.1 kDa
Released: 9 Feb 2011

Explore 3Q7O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3Q7O contains 3 α-helices and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	22-26	5
β-strand	45-50	6	1
β-strand	66-68	3	2
β-strand	71-75	5	2
β-strand	80-85	6	2
β-strand	91-96	6	2
β-strand	99	1	3
α-helix	105-106	2
β-strand	107	1	3
β-strand	111-118	8	4
β-strand	121-126	6	4
β-strand	130-135	6	4
β-strand	141-146	6	4
β-strand	156-158	3	5
β-strand	161-165	5	5
β-strand	170-175	6	5
β-strand	181-186	6	5
β-strand	201-203	3	6
β-strand	206-209	4	6
β-strand	215-220	6	6
β-strand	226-231	6	6
β-strand	252-254	3	7
β-strand	257-261	5	7
β-strand	266-271	6	7
β-strand	277-282	6	7
β-strand	286-292	7	8
β-strand	295-300	6	8
β-strand	305-309	5	8
β-strand	315-319	5	8
β-strand	327	1	9
β-strand	331-333	3	10
β-strand	336-340	5	10
β-strand	341	1	9
β-strand	345-350	6	10
β-strand	356-361	6	10
β-strand	367	1	11
α-helix	370-371	2
β-strand	372-374	3	1
β-strand	377-381	5	1
β-strand	382	1	11
β-strand	387-391	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein yfgL	A	protein	376	Escherichia coli	P77774 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3Q7O_1 Lipoprotein yfgL (chains A)
GAMGSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAAD
RAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNT
SDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRG
ESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNG
VVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTL
WTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADG
KLLIQAKDGTVYSITR

Primary citation

The Crystal Structure of BamB Suggests Interactions with BamA and Its Role within the BAM Complex. Noinaj, N., Fairman, J.W., Buchanan, S.K. J Mol Biol (2011) 407:248-260. DOI 10.1016/j.jmb.2011.01.042 · PubMed

Other PDB entries of the same protein (UniProt P77774 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q7M 1.65 Å, The crystal structure of BamB from the BAM complex in spacegroup I222
3Q7N 1.77 Å, The crystal structure of BamB from the BAM complex in spacegroup P212121
3PRW 1.8 Å, Crystal structure of the lipoprotein BamB
2YMS 2.1 Å, Structure and assembly of a b-propeller with nine blades and a new conserved repetitive…
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2YH3 2.6 Å, The structure of BamB from E. coli
3P1L 2.6 Å, Crystal structure of Escherichia coli BamB, a lipoprotein component of the beta-barrel…
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state

Browse structure collections

About this viewer

MolViewer shows 3Q7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.