3QJN: PDB entry 3QJN

Structural flexibility of Shank PDZ domain is important for its binding to different ligands. Determined by X-ray diffraction at 2.71 Å resolution. Released 13 Apr 2011.

Method: X-ray diffraction
Resolution: 2.71 Å
Organism: Rattus norvegicus
Chains: 16
Atoms: 6,545
Mol. weight: 108.83 kDa
Released: 13 Apr 2011

Explore 3QJN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QJN contains 22 α-helices and 58 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	1
β-strand	676-679	4	1
β-strand	701-705	5	1
α-helix	710-713	4
β-strand	721-725	5	1
β-strand	728-729	2	1
α-helix	735-743	9
β-strand	748-757	10	1

Chains B and E: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	1
β-strand	676-679	4	1
β-strand	701-705	5	1
α-helix	710-713	4
α-helix	720	1
β-strand	721-725	5	1
β-strand	728-729	2	1
α-helix	735-744	10
β-strand	748-757	10	1

Chain C: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	2
β-strand	676-679	4	2
β-strand	701-705	5	2
α-helix	710-713	4
β-strand	720-725	6	2
β-strand	728-729	2	2
α-helix	735-744	10
β-strand	748-757	10	2

Chains D and H: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	2
β-strand	676-680	5	2
β-strand	700-705	6	2
α-helix	710-713	4
α-helix	720	1
β-strand	721-725	5	2
β-strand	728-729	2	2
α-helix	735-744	10
β-strand	748-757	10	2

Chain F: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	3
β-strand	676-679	4	3
β-strand	701-705	5	3
α-helix	710-714	5
α-helix	720	1
β-strand	721-725	5	3
β-strand	728-729	2	3
α-helix	735-744	10
β-strand	748-757	10	3

Chain G: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	4
β-strand	676-679	4	4
β-strand	693	1	5
β-strand	696	1	5
β-strand	701-705	5	4
α-helix	710-713	4
α-helix	720	1
β-strand	721-725	5	4
β-strand	728-729	2	4
α-helix	735-744	10
β-strand	748-757	10	4

Chains I, J, K, L, M, N, O and P: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	643-645	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 and multiple ankyrin repeat domains protein 1	A, B, C, D, E, F, G, H	protein	115	Rattus norvegicus	Q9WV48 (AlphaFold model)
Beta-PIX	I, J, K, L, M, N, O, P	protein	7		O55043 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3QJN_1 SH3 and multiple ankyrin repeat domains protein 1 (chains A, B, C, D, E, F, G, H)
GSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWR
AGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHK

Sequence of entity 2 (I, J, K, L, M, N, O, P), FASTA

>3QJN_2 Beta-PIX (chains I, J, K, L, M, N, O, P)
AWDETNL

Primary citation

The structural flexibility of the shank1 PDZ domain is important for its binding to different ligands. Lee, J.H., Park, H., Park, S.J. et al. Biochem Biophys Res Commun (2011) 407:207-212. DOI 10.1016/j.bbrc.2011.02.141 · PubMed

Other PDB entries of the same protein (UniProt Q9WV48 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Q3O 1.8 Å, Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and…
7A9B 2.0 Å, Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide
1Q3P 2.25 Å, Crystal structure of the Shank PDZ-ligand complex reveals a class I PDZ interaction and…
3QJM 2.31 Å, Structural flexibility of Shank PDZ domain is important for its binding to different…
3L4F 2.8 Å, Crystal Structure of betaPIX Coiled-Coil Domain and Shank PDZ Complex

Browse structure collections

About this viewer

MolViewer shows 3QJN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.