3QO0: Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN

Monoclinic form of IgG1 Fab fragment (in complex with antigenic peptide) sharing same Fv as IgA. Determined by X-ray diffraction at 2.3 Å resolution. Released 15 Feb 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,548
Mol. weight: 49.78 kDa
Released: 15 Feb 2012

Explore 3QO0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QO0 contains 20 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	2
β-strand	50-54	5	2
β-strand	58-59	2	2
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
α-helix	85-87	3
β-strand	89-95	7	2
α-helix	101	1
β-strand	102-103	2	2
β-strand	107-111	5	2
α-helix	112	1
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158-159	2	6
β-strand	164-168	5	5
α-helix	169-172	4
β-strand	178-187	10	5
α-helix	188-193	6
β-strand	196-202	7	6
β-strand	210-215	6	6
α-helix	216-218	3

Chain B: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-39	7	8
β-strand	46-51	6	8
α-helix	54-56	3
β-strand	60-62	3	8
β-strand	70-75	6	7
β-strand	80-85	6	7
α-helix	90-92	3
β-strand	94-101	8	8
β-strand	108-109	2	8
β-strand	113-117	5	8
α-helix	121-122	2
β-strand	123	1	9
α-helix	124-125	2
β-strand	126-130	5	10
α-helix	134-136	3
β-strand	137-138	2	10
β-strand	141-151	11	10
β-strand	152	1	9
β-strand	157-160	4	11
α-helix	161-163	3
β-strand	165	1	11
β-strand	169-171	3	10
α-helix	172-174	3
β-strand	175-176	2	10
β-strand	182-191	10	10
α-helix	192-194	3
β-strand	201-206	6	11
α-helix	207-209	3
β-strand	211-216	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN	A	protein	219	Homo sapiens
Fab fragment of IMMUNOGLOBULIN G1 HEAVY CHAIN	B	protein	220	Homo sapiens
Peptide from Tubulin beta chain	C	protein	20		P07437 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3QO0_1 Fab fragment of IMMUNOGLOBULIN G1 LIGHT CHAIN (chains A)
DIVMTQSPLSLSVTPGEPASISCRSSQSLLRRDGHNDLEWYLQKPGQSPQPLIYLGSTRA
SGVPDRFSGSGSGTDFTLKIIRVEAEDAGTYYCMQNKQTPLTFGQGTRLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (B), FASTA

>3QO0_2 Fab fragment of IMMUNOGLOBULIN G1 HEAVY CHAIN (chains B)
EVQLVESGGGLVQPGGSLKLSCAASGFTLSGSNVHWVRQASGKGLEWVGRIKRNAESDAT
AYAASMRGRLTISRDDSKNTAFLQMNSLKSDDTAMYYCVIRGDVYNRQWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

Sequence of entity 3 (C), FASTA

>3QO0_3 Peptide from Tubulin beta chain (chains C)
YQQYQDATAEEEEDFGEEAE

Primary citation

Crystal structures of human IGA1 and IGG1 fab fragments sharing the same variable domains. Trajtenberg, F., Correa-Bove, A., Pritsch, O. et al. To be published.

Other PDB entries of the same protein (UniProt P07437 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QNZ 2.2 Å, Orthorhombic form of IgG1 Fab fragment (in complex with antigenic tubulin peptide)…
8BPO 2.8 Å, Structure of rabbit 80S ribosome translating beta-tubulin in complex with…
7TTT 2.9 Å, The beta-tubulin folding intermediate III
8V2J 2.9 Å, Structure of alpha1B and betaI/IVb microtubule bound to GDP
9COC 2.9 Å, Two protofilament structure of alpha1B and betaI/IVb microtubule bound to GDP
7TRG 3.0 Å, The beta-tubulin folding intermediate I
7X0S 3.1 Å, Human TRiC-tubulin-S3
9BP6 3.1 Å, Structure of alpha1B and betaI/IVb microtubule bound to GMPCPP
9CMM 3.1 Å, Two protofilament structure of alpha1B and betaI/IVb microtubule bound to GMPCPP
9HQ4 3.28 Å, TTLL11 bound to microtubule
7TTN 3.3 Å, The beta-tubulin folding intermediate II
6I2I 3.6 Å, Refined 13pf Hela Cell Tubulin microtubule (EML4-NTD decorated)

Browse structure collections

About this viewer

MolViewer shows 3QO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.