3QWR: IL-23

Crystal structure of IL-23 in complex with an adnectin. Determined by X-ray diffraction at 3.25 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,040
Mol. weight: 66.66 kDa
Released: 1 Feb 2012

Explore 3QWR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3QWR contains 14 α-helices and 37 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	8-10	3	1
β-strand	13-14	2	2
β-strand	23-27	5	3
β-strand	37-40	4	1
β-strand	48-49	2	1
β-strand	52-56	5	3
α-helix	60-62	3
β-strand	64-70	7	1
β-strand	73-81	9	1
β-strand	82	1	4
β-strand	84-86	3	2
β-strand	89-90	2	2
β-strand	95-96	2	4
α-helix	97	1
β-strand	108-110	3	4
β-strand	111	1	5
β-strand	117-124	8	4
β-strand	130-138	9	4
α-helix	143	1
β-strand	144-148	5	4
β-strand	152-156	5	4
β-strand	165-173	9	4
β-strand	186-194	9	4
β-strand	197-205	9	4
α-helix	207-210	4
β-strand	211	1	5
α-helix	213-216	4
β-strand	217-223	7	6
β-strand	230-235	6	6
β-strand	249-255	7	7
β-strand	266-269	4	7
β-strand	273-276	4	6
β-strand	284-290	7	7
α-helix	296-300	5
β-strand	301-303	3	7

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	11-27	17
α-helix	54-56	3
α-helix	60-65	6
α-helix	68-85	18
α-helix	95-97	3
α-helix	102-116	15
α-helix	136-167	32

Chain D: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	8
β-strand	17-22	6	8
β-strand	31-38	8	9
β-strand	46-51	6	9
β-strand	56-59	4	8
β-strand	68-75	8	9
α-helix	85-87	3
β-strand	88-92	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A	protein	306	Homo sapiens	P29460 (AlphaFold model)
Interleukin-23 subunit alpha	B	protein	170	Homo sapiens	Q9NPF7 (AlphaFold model)
Adnectin	D	protein	109	Homo sapiens

Sequence of entity 1 (A), FASTA

>3QWR_1 Interleukin-12 subunit beta (chains A)
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEF
GDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTC
WWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAA
EESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW
ASVPCS

Sequence of entity 2 (B), FASTA

>3QWR_2 Interleukin-23 subunit alpha (chains B)
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDP
QGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEG
HHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Sequence of entity 3 (D), FASTA

>3QWR_3 ADNECTIN (chains D)
MGVSDVPRDLEVVAATPTSLLISWEHDYPYRRYYRITYGETGGNSPVQEFTVPKDVDTAT
ISGLKPGVDYTITVYAVTSSYKYDMQYSPISINYRTEIDKPSQHHHHHH

Primary citation

Structures of adnectin/protein complexes reveal an expanded binding footprint. Ramamurthy, V., Krystek, S.R., Bush, A. et al. Structure (2012) 20:259-269. DOI 10.1016/j.str.2011.11.016 · PubMed

Other PDB entries of the same protein (UniProt P29460 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MJ3 1.74 Å, Interleukin-23 complex with an antagonistic alphabody, crystal form 1
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
8CR8 2.0 Å, human Interleukin-23
3DUH 2.3 Å, Structure of Interleukin-23
8UUI 2.43 Å, X-ray structure of Interleukin-23 in complex with peptide 23-446
1F42 2.5 Å, The P40 domain of human interleukin-12
5MXA 2.5 Å, Structure of unbound Interleukin-23
4GRW 2.55 Å, Structure of a complex of human IL-23 with 3 Nanobodies (Llama vHHs)
6UIB 2.74 Å, Crystal structure of IL23 bound to peptide 23-652
1F45 2.8 Å, Human interleukin-12
5MZV 2.8 Å, IL-23:IL-23R:Nb22E11 complex
3D87 2.9 Å, Crystal structure of Interleukin-23

Browse structure collections

About this viewer

MolViewer shows 3QWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.