3R42: Yeast vps23 UEV domain

Crystal structure of the yeast vps23 UEV domain in complex with a vps27 PSDP peptide. Determined by X-ray diffraction at 1.87 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,446
Mol. weight: 19.09 kDa
Released: 4 May 2011

Explore 3R42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R42 contains 9 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-24	14
α-helix	28-41	14
β-strand	46-53	8	1
α-helix	54	1
β-strand	59-70	12	1
α-helix	77-78	2
β-strand	80-86	7	1
β-strand	97-100	4	1
α-helix	107-109	3
α-helix	115-119	5
β-strand	120	1	2
β-strand	125	1	1
β-strand	126	1	2
α-helix	129-132	4
α-helix	141-152	12
α-helix	154-157	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	448	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease	A	protein	162	Saccharomyces cerevisiae	P25604 (AlphaFold model)
Vacuolar protein sorting-associated protein 27	B	protein	9	Saccharomyces cerevisiae	P40343 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3R42_1 Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease (chains A)
GAMSANGKISVPEAVVNWLFKVIQPIYNDGRTTFHDSLALLDNFHSLRPRTRVFTHSDGT
PQLLLSIYGTISTGEDGSSPHSIPVIMWVPSMYPVKPPFISINLENFDMNTISSSLPIQE
YIDSNGWIALPILHAWDPAAMNLIMVVQELMSLLHEPPQDQA

Sequence of entity 2 (B), FASTA

>3R42_2 Vacuolar protein sorting-associated protein 27 (chains B)
QVPSDPYNY

Primary citation

Structural basis for endosomal recruitment of ESCRT-I by ESCRT-0 in yeast. Ren, X., Hurley, J.H. EMBO J (2011) 30:2130-2139. DOI 10.1038/emboj.2011.122 · PubMed

Other PDB entries of the same protein (UniProt P25604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R3Q 1.45 Å, Crystal structure of the yeast Vps23 UEV domain
1UZX 1.85 Å, A complex of the Vps23 UEV with ubiquitin
2F6M 2.1 Å, Structure of a Vps23-C:Vps28-N subcomplex
2P22 2.7 Å, Structure of the Yeast ESCRT-I Heterotetramer Core
2F66 2.8 Å, Structure of the ESCRT-I endosomal trafficking complex
2CAZ 3.6 Å, ESCRT-I core

Browse structure collections

About this viewer

MolViewer shows 3R42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.