3R7W: Gtr1p-Gtr2p complex

Crystal Structure of Gtr1p-Gtr2p complex. Determined by X-ray diffraction at 2.77 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 2.77 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 9,011
Mol. weight: 150.39 kDa
Ligands: GNP, MG
Released: 24 Aug 2011

Explore 3R7W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R7W contains 41 α-helices and 42 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
α-helix	19-27	9
α-helix	33-37	5
α-helix	40-42	3
β-strand	44-51	8	1
β-strand	55-62	8	1
α-helix	66-73	8
α-helix	77-81	5
β-strand	86-92	7	1
α-helix	98-115	18
β-strand	120-126	7	1
α-helix	128-130	3
α-helix	133-152	20
β-strand	160-163	4	1
α-helix	170-180	11
α-helix	186-200	15
β-strand	202-209	8	2
β-strand	215-218	4	2
α-helix	242-257	16
α-helix	258-260	3
β-strand	264-269	6	2
β-strand	273-277	5	2
β-strand	282-288	7	2
α-helix	295-301	7

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	3
α-helix	24-30	7
α-helix	36-38	3
β-strand	50-52	3	3
β-strand	58-62	5	3
α-helix	74-80	7
β-strand	85-89	5	3
α-helix	98-113	16
β-strand	118-122	5	3
α-helix	132-147	16
β-strand	159-162	4	3
α-helix	170-179	10
α-helix	186-193	8
α-helix	195-197	3
β-strand	202-209	8	2
β-strand	217-218	2	2
α-helix	225-242	18
β-strand	270-275	6	2
β-strand	280-285	6	2
β-strand	290-296	7	2
α-helix	303-322	20

Chain C: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	4
α-helix	19-27	9
α-helix	34-37	4
α-helix	40-42	3
β-strand	44-51	8	4
β-strand	55-62	8	4
α-helix	66-73	8
α-helix	77-81	5
β-strand	84-92	9	4
α-helix	98-115	18
β-strand	120-126	7	4
α-helix	133-152	20
β-strand	160-164	5	4
α-helix	170-180	11
α-helix	186-200	15
β-strand	202-209	8	5
β-strand	215-218	4	5
α-helix	242-257	16
β-strand	266-269	4	5
β-strand	273-277	5	5
β-strand	282-288	7	5
α-helix	295-305	11

Chain D: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	6
α-helix	22-27	6
β-strand	86-89	4	6
α-helix	98-111	14
β-strand	119-123	5	6
α-helix	134-148	15
β-strand	160-163	4	6
α-helix	170-180	11
α-helix	195-197	3
β-strand	202-206	5	5
β-strand	218	1	5
α-helix	225-244	20
β-strand	270-274	5	5
β-strand	280-285	6	5
β-strand	291-296	6	5
α-helix	303-322	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTP-binding protein GTR1	A, C	protein	307	Saccharomyces cerevisiae	Q00582 (AlphaFold model)
GTP-binding protein GTR2	B, D	protein	331	Saccharomyces cerevisiae	P53290 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>3R7W_1 GTP-binding protein GTR1 (chains A, C)
PLGSKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCG
GQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFV
LLHKMDLVQLDKREELFQIMMKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLI
PNMSNHQSNLKKFKEIMNALEIILFERTTFLVICSSNGENSNENHDSSDNNNVLLDPKRF
EKISNIMKNFKQSCTKLKSGFKTLILNNNIYVSELSSNMVCFIVLKDMNIPQELVLENIK
KAKEFFQ

Sequence of entity 2 (B, D), FASTA

>3R7W_2 GTP-binding protein GTR2 (chains B, D)
MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYF
EPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLS
EDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLE
NMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPVL
RNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVA
DYNIDIFKKGLEDIWANARASQAKNSIEDDV

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	4
MG	Magnesium ion	Mg	4

Primary citation

Crystal structure of the Gtr1p-Gtr2p complex reveals new insights into the amino acid-induced TORC1 activation. Gong, R., Li, L., Liu, Y. et al. Genes Dev (2011) 25:1668-1673. DOI 10.1101/gad.16968011 · PubMed

Other PDB entries of the same protein (UniProt Q00582 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ARZ 3.1 Å, The crystal structure of Gtr1p-Gtr2p complexed with GTP-GDP
9H4Q 3.1 Å, Cryo-EM structure of the SEAC wing - EGOC
6JWP 3.2 Å, crystal structure of EGOC
9H5K 3.2 Å, Cryo-EM structure of the SEAC-EGOC supercomplex

Browse structure collections

About this viewer

MolViewer shows 3R7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.