The crystal structure of Gtr1p-Gtr2p complexed with GTP-GDP. Determined by X-ray diffraction at 3.1 Å resolution. Released 25 Jul 2012.
Explore 4ARZ in 3D Show helices and sheets RCSB PDB PDBe
4ARZ contains 24 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-13 | 8 | 1 |
| α-helix | 19-27 | 9 | |
| α-helix | 33-38 | 6 | |
| α-helix | 40-42 | 3 | |
| β-strand | 44-51 | 8 | 1 |
| β-strand | 55-62 | 8 | 1 |
| α-helix | 66-73 | 8 | |
| α-helix | 77-80 | 4 | |
| β-strand | 86-92 | 7 | 1 |
| α-helix | 98-115 | 18 | |
| β-strand | 120-126 | 7 | 1 |
| α-helix | 133-153 | 21 | |
| β-strand | 160-164 | 5 | 1 |
| α-helix | 170-179 | 10 | |
| α-helix | 187-200 | 14 | |
| β-strand | 204-209 | 6 | 2 |
| β-strand | 215-219 | 5 | 2 |
| α-helix | 242-254 | 13 | |
| β-strand | 264-269 | 6 | 2 |
| β-strand | 273-277 | 5 | 2 |
| β-strand | 282-287 | 6 | 2 |
| α-helix | 295-308 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 3 |
| β-strand | 13-17 | 5 | 4 |
| α-helix | 22-32 | 11 | |
| α-helix | 34-38 | 5 | |
| α-helix | 39-43 | 5 | |
| α-helix | 48-50 | 3 | |
| β-strand | 54 | 1 | 3 |
| β-strand | 59-63 | 5 | 4 |
| α-helix | 74-82 | 9 | |
| β-strand | 85-91 | 7 | 4 |
| α-helix | 97-113 | 17 | |
| β-strand | 118-124 | 7 | 4 |
| α-helix | 131-146 | 16 | |
| α-helix | 148-151 | 4 | |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 170-182 | 13 | |
| α-helix | 184-186 | 3 | |
| α-helix | 188-196 | 9 | |
| β-strand | 202-209 | 8 | 2 |
| β-strand | 217-218 | 2 | 2 |
| α-helix | 228-245 | 18 | |
| β-strand | 270-275 | 6 | 2 |
| β-strand | 280-285 | 6 | 2 |
| β-strand | 290-296 | 7 | 2 |
| α-helix | 303-324 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTP-binding protein GTR1 | A | protein | 310 | SACCHAROMYCES CEREVISIAE | Q00582 (AlphaFold model) |
| GTP-binding protein GTR2 | B | protein | 341 | SACCHAROMYCES CEREVISIAE | P53290 (AlphaFold model) |
>4ARZ_1 GTP-BINDING PROTEIN GTR1 (chains A) MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLW DCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAK IFVLLHKMDLVQLDKREELFQIMMKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVC SLIPNMSNHQSNLKKFKEIMNALEIILFERTTFLVICSSNGENSNENHDSSDNNNVLLDP KRFEKISNIMKNFKQSCTKLKSGFKTLILNNNIYVSELSSNMVCFIVLKDMNIPQELVLE NIKKAKEFFQ
>4ARZ_2 GTP-BINDING PROTEIN GTR2 (chains B) MSLEATDSKAMVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAV MELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIE VLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQ KLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTID LFDLYKAPVLRNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNG TDMESCLTVADYNIDIFKKGLEDIWANARASQAKNSIEDDV
| ID | Name | Formula | Copies |
|---|---|---|---|
| GTP | Guanosine-5'-triphosphate | C10 H16 N5 O14 P3 | 1 |
| MG | Magnesium ion | Mg | 1 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion. Jeong, J.H., Lee, K.H., Kim, Y.M. et al. J Biol Chem (2012) 287:29648. DOI 10.1074/JBC.C112.384420 · PubMed
Other PDB entries of the same protein (UniProt Q00582 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ARZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.