3R85: Human SOUL BH3 domain

Crystal structure of human SOUL BH3 domain in complex with Bcl-xL. Determined by X-ray diffraction at 1.95 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,309
Mol. weight: 83.11 kDa
Released: 29 Jun 2011

Explore 3R85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3R85 contains 41 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	26-100	19
α-helix	102-110	9
α-helix	118-130	13
α-helix	137-156	20
α-helix	162-173	12
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-195	9

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	26-100	19
α-helix	104-107	4
α-helix	119-130	12
α-helix	137-156	20
α-helix	160-162	3
α-helix	163-173	11
α-helix	174-178	5
α-helix	179-184	6
α-helix	188-195	8

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-19	13
α-helix	26-100	19
α-helix	102-109	8
α-helix	116-131	16
α-helix	137-156	20
α-helix	162-173	12
α-helix	174-178	5
α-helix	179-184	6
α-helix	187-195	9

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	4-18	15
α-helix	26-100	19
α-helix	103-109	7
α-helix	121-130	10
α-helix	137-155	19
α-helix	163-173	11
α-helix	174-178	5
α-helix	179-184	6
α-helix	188-195	8

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	156-168	13

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	153-168	16

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	158-167	10

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	153-169	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 1	A, B, C, D	protein	156	Homo sapiens	Q07817 (AlphaFold model)
Heme-binding protein 2	E, F, G, H	protein	26	Homo sapiens	Q9Y5Z4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3R85_1 Bcl-2-like protein 1 (chains A, B, C, D)
GSHMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLTSQLH
ITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATY
LNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER

Sequence of entity 2 (E, F, G, H), FASTA

>3R85_2 Heme-binding protein 2 (chains E, F, G, H)
SAQKNQEQLLTLASILREDGKVFDEK

Primary citation

Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL. Ambrosi, E., Capaldi, S., Bovi, M. et al. Biochem J (2011) 438:291-301. DOI 10.1042/BJ20110257 · PubMed

Other PDB entries of the same protein (UniProt Q07817 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JGW 1.3 Å, Crystal structure of BCL-XL in complex with COMPOUND 1620116, CRYSTAL FORM 1
3SP7 1.4 Å, Crystal Structure of Bcl-xL bound to BM903
7YAA 1.4 Å, Crystal structure analysis of cp3 bound BCLxl
7LH7 1.41 Å, Crystal structure of BCL-XL in complex with a benzothiazole-based inhibitor
9IGG 1.5 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
4QVF 1.53 Å, Crystal structure of Bcl-xL in complex with BIM BH3 domain
4A1U 1.54 Å, Crystal structure of alpha-beta-foldamer 2c in complex with Bcl-xL
6VWC 1.6 Å, Crystal structure of Bcl-xL in complex with tetrahydroisoquinoline-pyridine based…
6O0K 1.62 Å, crystal structure of BCL-2 with venetoclax
3SPF 1.7 Å, Crystal Structure of Bcl-xL bound to BM501
9I9E 1.7 Å, Structure of human Bcl-xL in complex with small molecule inhibitor
9O14 1.73 Å, Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2

Browse structure collections

About this viewer

MolViewer shows 3R85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.