3RDV: SLAIN2c-CLIPCG1 complex

Structure of the SLAIN2c-CLIPCG1 complex. Determined by X-ray diffraction at 1.75 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 8
Atoms: 2,766
Mol. weight: 36.2 kDa
Released: 29 Jun 2011

Explore 3RDV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RDV contains 6 α-helices and 32 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	63-66	4	1
β-strand	70-78	9	1
β-strand	87-92	6	1
β-strand	99	1	1
β-strand	102-103	2	2
β-strand	106-107	2	2
β-strand	116-119	4	1
α-helix	121-123	3
β-strand	124-125	2	1

Chains B and D: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	63-66	4	3
β-strand	70-78	9	3
β-strand	87-92	6	3
β-strand	99	1	3
β-strand	102-103	2	4
β-strand	106-107	2	4
β-strand	116-119	4	3
α-helix	121-123	3
β-strand	124-126	3	3

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	575-577	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CAP-Gly domain-containing linker protein 1	A, B, C, D	protein	72	Homo sapiens	P30622 (AlphaFold model)
SLAIN motif-containing protein 2	E, F, G, H	protein	8	Homo sapiens	Q9P270 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3RDV_1 CAP-Gly domain-containing linker protein 1 (chains A, B, C, D)
DDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLK
GIFTRPSKLTRK

Sequence of entity 2 (E, F, G, H), FASTA

>3RDV_2 SLAIN motif-containing protein 2 (chains E, F, G, H)
DSWKDGCY

Primary citation

SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase. van der Vaart, B., Manatschal, C., Grigoriev, I. et al. J Cell Biol (2011) 193:1083-1099. DOI 10.1083/jcb.201012179 · PubMed

Other PDB entries of the same protein (UniProt P30622 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2E3H 1.45 Å, Crystal structure of the CLIP-170 CAP-Gly domain 2
2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
8WHI 1.85 Å, Crystal structure of native CLASP2 in complex with CLIP170
2E3I 2.0 Å, Crystal structure of the CLIP-170 CAP-Gly domain 1
2QK0 2.0 Å, Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170 and EB1
3E2U 2.6 Å, Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly…
8WHH 3.8 Å, Crystal structure of Se-Met derivative CLASP2 in complex with CLIP170
2CP5 Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
2CP6 Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
2E4H Solution structure of cytoskeletal protein in complex with tubulin tail

Browse structure collections

About this viewer

MolViewer shows 3RDV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.