4H62: PDB entry 4H62

Structure of the Saccharomyces cerevisiae Mediator subcomplex Med17C/Med11C/Med22C. Determined by X-ray diffraction at 3.0 Å resolution. Released 31 Oct 2012.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Saccharomyces cerevisiae
Chains: 3
Atoms: 2,556
Mol. weight: 44.49 kDa
Released: 31 Oct 2012

Explore 4H62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4H62 contains 14 α-helices and 10 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain K: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	94-109	16

Chain Q: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	388-396	9	1
β-strand	403-408	6	1
α-helix	425-449	25
α-helix	451-455	5
β-strand	457-461	5	1
β-strand	464-468	5	1
β-strand	472-479	8	1
α-helix	498-524	27
α-helix	535-538	4
α-helix	542-562	21
α-helix	563-567	5
β-strand	574-579	6	2
α-helix	597-604	8
α-helix	607-610	4
α-helix	612-613	2
β-strand	614-620	7	2
α-helix	622-624	3
β-strand	630-636	7	2
β-strand	644-650	7	2
β-strand	660-664	5	2
α-helix	667-677	11
α-helix	678-682	5

Chain V: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	101-116	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mediator of RNA polymerase II transcription subunit 11	K	protein	40	Saccharomyces cerevisiae	Q99278 (AlphaFold model)
Mediator of RNA polymerase II transcription subunit 22	V	protein	31	Saccharomyces cerevisiae	P32570 (AlphaFold model)
Mediator of RNA polymerase II transcription subunit 17	Q	protein	312	Saccharomyces cerevisiae	P32569 (AlphaFold model)

Sequence of entity 1 (K), FASTA

>4H62_1 Mediator of RNA polymerase II transcription subunit 11 (chains K)
GSHMINVNKKALGQDTEKMEEQLDLLSAILDPSKSKGAGS

Sequence of entity 2 (V), FASTA

>4H62_2 Mediator of RNA polymerase II transcription subunit 22 (chains V)
GAGSGVTRFDEKQIEELLDNCIETFVAEKTT

Sequence of entity 3 (Q), FASTA

>4H62_3 Mediator of RNA polymerase II transcription subunit 17 (chains Q)
MKGTDFVHSVKKFLRVRIFTKIESEDDYILSGESVMDRDSESEEAETKDIRKQIQLLKKI
IFEKELMYQIKKECALLISYGVSIENENKVIIELPNEKFEIELLSLDDDSIVNHEQDLPK
INDKRANLMLVMLRLLLVVIFKKTLRSRISSPHGLINLNVDDDILIIRPILGKVRFANYK
LLLKKIIKDYVLDIVPGSSITETEVEREQPQENKNIDDENITKLNKEIRAFDKLLNIPRR
ELKINLPLTEHKSPNLSLMLESPNYCNALIHIKFSAGTEANAVSFDTTFSDFKEVEDFLH
FIVAEYIQQKKV

Primary citation

Structure of the Mediator head module. Lariviere, L., Plaschka, C., Seizl, M. et al. Nature (2012) 492:448-451. DOI 10.1038/nature11670 · PubMed

Other PDB entries of the same protein (UniProt Q99278 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3R84 2.05 Å, Structure of the Mediator head subcomplex Med11/22
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
9PC8 3.4 Å, Core Mediator of PIC-Med-SWI/SNF
8CEO 3.6 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator and the…
4GWP 4.2 Å, Structure of the Mediator Head Module from S. cerevisiae
3RJ1 4.3 Å, Architecture of the Mediator Head module
7UIG 4.3 Å, Mediator-PIC Early (Mediator A)
4GWQ 4.5 Å, Structure of the Mediator Head Module from S. cerevisiae in complex with the…
7UIF 4.6 Å, Mediator-PIC Early (Core B)
5OQM 5.8 Å, Structure of yeast transcription pre-initiation complex with tfiih and core mediator

Browse structure collections

About this viewer

MolViewer shows 4H62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.