3RNY: Human RSK1 C-terminal kinase domain

Crystal structure of human RSK1 C-terminal kinase domain. Determined by X-ray diffraction at 2.7 Å resolution. Released 25 Apr 2012.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,068
Mol. weight: 77.69 kDa
Released: 25 Apr 2012

Explore 3RNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RNY contains 35 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	423	1	1
β-strand	433-435	3	1
β-strand	444-446	3	1
α-helix	457-466	10
β-strand	472	1	2
α-helix	473-474	2
β-strand	475-477	3	1
β-strand	488-489	2	1
α-helix	490-492	3
β-strand	496	1	2
α-helix	497-501	5
α-helix	509-528	20
β-strand	531-532	2	3
α-helix	538-540	3
β-strand	541-543	3	2
α-helix	550-552	3
β-strand	553-555	3	2
β-strand	562-563	2	3
β-strand	565	1	4
β-strand	571	1	4
α-helix	574-576	3
α-helix	585-609	25
α-helix	622-631	10
α-helix	639-643	5
α-helix	646-655	10
α-helix	664-665	2
α-helix	666-669	4
α-helix	673-676	4
α-helix	678-680	3
α-helix	685-687	3
α-helix	691-706	16

Chain B: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	433-436	4	5
β-strand	443-450	8	5
α-helix	457-466	10
β-strand	472	1	6
α-helix	473-474	2
β-strand	475-480	6	5
β-strand	484-489	6	5
α-helix	490-492	3
β-strand	496	1	6
α-helix	497-501	5
α-helix	509-528	20
β-strand	531-532	2	7
α-helix	538-540	3
β-strand	541-543	3	6
α-helix	550-552	3
β-strand	553-555	3	6
β-strand	562-563	2	7
β-strand	565	1	8
β-strand	571	1	8
α-helix	587-609	23
α-helix	622-631	10
α-helix	639-643	5
α-helix	646-655	10
α-helix	664-665	2
α-helix	666-669	4
α-helix	673-676	4
α-helix	678-680	3
α-helix	685-687	3
α-helix	691-706	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6 kinase alpha-1	A, B	protein	346	Homo sapiens	Q15418 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3RNY_1 Ribosomal protein S6 kinase alpha-1 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVI
DKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSE
REASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRI
GSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQ
DLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

Primary citation

Structural basis for the autoinhibition of the C-terminal kinase domain of human RSK1. Li, D., Fu, T.M., Nan, J. et al. Acta Crystallogr D Biol Crystallogr (2012) 68:680-685. DOI 10.1107/S0907444912007457 · PubMed

Other PDB entries of the same protein (UniProt Q15418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V62 1.9 Å, Phospho-ERK2 bound to bivalent inhibitor SBP3
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
2Z7Q 2.0 Å, Crystal structure of the N-terminal kinase domain of human RSK-1 bound to AMP-PCP
2Z7R 2.0 Å, Crystal Structure of the N-terminal Kinase Domain of Human RSK1 bound to Staurosporine
2Z7S 2.1 Å, Crystal Structure of the N-terminal Kinase Domain of Human RSK1 bound to Purvalnol A
5CSI 2.13 Å, S100B-RSK1 crystal structure A'
4NIF 2.15 Å, Heterodimeric structure of ERK2 and RSK1
5V61 2.2 Å, Phospho-ERK2 bound to bivalent inhibitor SBP2
4H3P 2.3 Å, Crystal structure of human ERK2 complexed with a MAPK docking peptide
5N7D 2.3 Å, MAGI-1 complexed with a RSK1 peptide
5N7F 2.3 Å, MAGI-1 complexed with a pRSK1 peptide
6TWY 2.3 Å, MAGI1_2 complexed with a phosphomimetic RSK1 peptide

Browse structure collections

About this viewer

MolViewer shows 3RNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.