3RO3: LGN/mInscuteable complex

crystal structure of LGN/mInscuteable complex. Determined by X-ray diffraction at 1.1 Å resolution. Released 7 Mar 2012.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,866
Mol. weight: 21.48 kDa
Ligands: EOH
Released: 7 Mar 2012

Explore 3RO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RO3 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	191-207	17
α-helix	211-228	18
α-helix	231-247	17
α-helix	251-267	17
α-helix	271-287	17
α-helix	291-307	17
α-helix	311-328	18
α-helix	331-346	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	68-77	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2	A	protein	164	Mus musculus	Q8VDU0 (AlphaFold model)
peptide of Protein inscuteable homolog	B	protein	22	Mus musculus	Q3HNM7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3RO3_1 G-protein-signaling modulator 2 (chains A)
GPGSRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERIAYSNLGNAYI
FLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQ
ELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGD

Sequence of entity 2 (B), FASTA

>3RO3_2 peptide of Protein inscuteable homolog (chains B)
RLHFMQVDSVQRWMEDLKLMTE

Ligands and cofactors

ID	Name	Formula	Copies
EOH	Ethanol	C2 H6 O	1

Water and common crystallization additives (CL, GOL) are not listed.

Primary citation

LGN/mInsc and LGN/NuMA complex structures suggest distinct functions in asymmetric cell division for the Par3/mInsc/LGN and G[alpha]i/LGN/NuMA pathways. Zhu, J., Wen, W., Zheng, Z. et al. Mol Cell (2011) 43:418-431. DOI 10.1016/j.molcel.2011.07.011 · PubMed

Other PDB entries of the same protein (UniProt Q8VDU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RO2 2.3 Å, Structures of the LGN/NuMA complex
4G2V 2.4 Å, Structure complex of LGN binding with FRMPD1
7EP7 2.6 Å, The complex structure of Gpsm2 and Whirlin
4JHR 2.8 Å, An auto-inhibited conformation of LGN reveals a distinct interaction mode between GoLoco…
4G5O 2.9 Å, Structure of LGN GL4/Galphai3(Q147L) complex
4G5Q 2.9 Å, Structure of LGN GL4/Galphai1 complex
4G5R 3.48 Å, Structure of LGN GL4/Galphai3 complex
4G5S 3.62 Å, Structure of LGN GL3/Galphai3 complex

Browse structure collections

About this viewer

MolViewer shows 3RO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.