4G5S: LGN GL3/Galphai3 complex
Structure of LGN GL3/Galphai3 complex. Determined by X-ray diffraction at 3.62 Å resolution. Released 5 Sept 2012.
- Method
- X-ray diffraction
- Resolution
- 3.62 Å
- Organisms
- Homo sapiens, Mus musculus
- Chains
- 8
- Atoms
- 10,226
- Mol. weight
- 164.76 kDa
- Ligands
- CIT, GDP
- Released
- 5 Sept 2012
Explore 4G5S in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4G5S contains 75 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 18 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 33-39 | 7 | 1 |
| α-helix | 46-56 | 11 | |
| α-helix | 63-68 | 6 | |
| α-helix | 70-91 | 22 | |
| α-helix | 100-110 | 11 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-157 | 6 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-175 | 5 | |
| β-strand | 179 | 1 | 2 |
| β-strand | 185-190 | 6 | 1 |
| β-strand | 195-200 | 6 | 1 |
| α-helix | 210-213 | 4 | |
| β-strand | 220-226 | 7 | 1 |
| α-helix | 227-230 | 4 | |
| α-helix | 232-235 | 4 | |
| α-helix | 242-254 | 13 | |
| β-strand | 263-269 | 7 | 1 |
| α-helix | 271-278 | 8 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 1 |
| α-helix | 329-348 | 20 | |
Chain B: 18 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 33-39 | 7 | 3 |
| α-helix | 46-56 | 11 | |
| α-helix | 63-68 | 6 | |
| α-helix | 70-91 | 22 | |
| α-helix | 100-110 | 11 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-157 | 6 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-175 | 5 | |
| β-strand | 179 | 1 | 4 |
| β-strand | 185-191 | 7 | 3 |
| β-strand | 194-200 | 7 | 3 |
| α-helix | 210-213 | 4 | |
| β-strand | 220-226 | 7 | 3 |
| α-helix | 227-230 | 4 | |
| α-helix | 232-235 | 4 | |
| α-helix | 242-254 | 13 | |
| β-strand | 263-269 | 7 | 3 |
| α-helix | 271-277 | 7 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 3 |
| α-helix | 329-347 | 19 | |
Chain C: 17 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 33-39 | 7 | 5 |
| α-helix | 46-56 | 11 | |
| α-helix | 63-68 | 6 | |
| α-helix | 70-91 | 22 | |
| α-helix | 100-110 | 11 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-157 | 6 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-175 | 5 | |
| β-strand | 179 | 1 | 6 |
| β-strand | 185-191 | 7 | 5 |
| β-strand | 194-200 | 7 | 5 |
| α-helix | 210-213 | 4 | |
| β-strand | 220-226 | 7 | 5 |
| α-helix | 227-230 | 4 | |
| α-helix | 242-254 | 13 | |
| β-strand | 263-269 | 7 | 5 |
| α-helix | 271-277 | 7 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 5 |
| α-helix | 329-349 | 21 | |
Chain D: 18 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 33-40 | 8 | 7 |
| α-helix | 46-56 | 11 | |
| α-helix | 63-68 | 6 | |
| α-helix | 70-91 | 22 | |
| α-helix | 100-110 | 11 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-157 | 6 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-175 | 5 | |
| β-strand | 179 | 1 | 8 |
| β-strand | 185-191 | 7 | 7 |
| β-strand | 194-200 | 7 | 7 |
| α-helix | 211-215 | 5 | |
| β-strand | 220-226 | 7 | 7 |
| α-helix | 227-230 | 4 | |
| α-helix | 232-235 | 4 | |
| α-helix | 242-254 | 13 | |
| β-strand | 263-269 | 7 | 7 |
| α-helix | 271-277 | 7 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 7 |
| α-helix | 329-349 | 21 | |
Chains E, F and G: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 590-597 | 8 | |
| β-strand | 607 | 1 | 2 |
Chain Z: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 592-597 | 6 | |
| β-strand | 607 | 1 | 8 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Guanine nucleotide-binding protein G(k) subunit alpha | A, B, C, D | protein | 330 | Homo sapiens | P08754 (AlphaFold model) |
| G-protein-signaling modulator 2 | E, F, G, Z | protein | 25 | Mus musculus | Q8VDU0 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>4G5S_1 Guanine nucleotide-binding protein G(k) subunit alpha (chains A, B, C, D)
EDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAI
IRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACFSRSR
EYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQ
RSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSI
ILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFT
CATDTKNVQFVFDAVTDVIIKNNLKECGLY
Sequence of entity 2 (E, F, G, Z), FASTA
>4G5S_2 G-protein-signaling modulator 2 (chains E, F, G, Z)
DEDFFDILVKCQGSRLDDQRCAPPS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CIT | Citric acid | C6 H8 O7 | 2 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 3 |
Primary citation
Crystal structures of the scaffolding protein LGN reveal the general mechanism by which GoLoco binding motifs inhibit the release of GDP from G alpha i. Jia, M., Li, J., Zhu, J. et al. J Biol Chem (2012) 287:36766-36776. DOI 10.1074/jbc.M112.391607 · PubMed
Other PDB entries of the same protein (UniProt P08754 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2ODE 1.9 Å, Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3
- 9YCX 2.1 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the…
- 9YCY 2.2 Å, Neurotensin Receptor 1 (NTSR1) bound to Octotensin in complex with Gi3 in the Canonical…
- 8IKL 2.33 Å, Cryo-EM structure of the CD97-G13 complex
- 8YK0 2.4 Å, Cryo-EM structure of human GPR156-Gi3 complex
- 7T10 2.5 Å, CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
- 9VJ6 2.62 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with F-15599
- 7T11 2.7 Å, CryoEM structure of somatostatin receptor 2 in complex with Octreotide and Gi3.
- 9VJF 2.7 Å, Cryo-EM structure of 5-HT1AR-Gi3 in complex with buspirone
- 2IHB 2.71 Å, Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
- 2V4Z 2.8 Å, The crystal structure of the human G-protein subunit alpha (GNAI3) in complex with an…
- 7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
Browse structure collections
About this viewer
MolViewer shows 4G5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.