4JHR: G-protein-signaling modulator 2

An auto-inhibited conformation of LGN reveals a distinct interaction mode between GoLoco motifs and TPR motifs. Determined by X-ray diffraction at 2.8 Å resolution. Released 5 Jun 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,249
Mol. weight: 73.76 kDa
Released: 5 Jun 2013

Explore 4JHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JHR contains 26 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	111-127	17
α-helix	131-149	19
α-helix	167-188	22
α-helix	191-208	18
α-helix	211-227	17
α-helix	231-247	17
α-helix	251-267	17
α-helix	271-288	18
α-helix	291-307	17
α-helix	311-326	16
α-helix	331-349	19
β-strand	586	1	1
α-helix	591-594	4
β-strand	614	1	1
α-helix	625-639	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
G-protein-signaling modulator 2	A, B	protein	333	Mus musculus	Q8VDU0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4JHR_1 G-protein-signaling modulator 2 (chains A, B)
GPGSGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNV
YHAKGKSFGCPGPQDTGEFPEDVRNALQAAVDLYEENLSLVTALGDRAAQGRAFGNLGNT
HYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLL
ARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELKDRIGEGRACWSLGNA
YTALGNHDQAMHFAEKHLEISREVGDLEVLFQGPPDEDFFDILVKCQGSRLDDQRCAPPS
AATKGPTVPDEDFFSLILRSQAKRMDEQRVLLQ

Primary citation

An autoinhibited conformation of LGN reveals a distinct interaction mode between GoLoco motifs and TPR motifs. Pan, Z., Zhu, J., Shang, Y. et al. Structure (2013) 21:1007-1017. DOI 10.1016/j.str.2013.04.005 · PubMed

Other PDB entries of the same protein (UniProt Q8VDU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RO3 1.1 Å, crystal structure of LGN/mInscuteable complex
3RO2 2.3 Å, Structures of the LGN/NuMA complex
4G2V 2.4 Å, Structure complex of LGN binding with FRMPD1
7EP7 2.6 Å, The complex structure of Gpsm2 and Whirlin
4G5O 2.9 Å, Structure of LGN GL4/Galphai3(Q147L) complex
4G5Q 2.9 Å, Structure of LGN GL4/Galphai1 complex
4G5R 3.48 Å, Structure of LGN GL4/Galphai3 complex
4G5S 3.62 Å, Structure of LGN GL3/Galphai3 complex

Browse structure collections

About this viewer

MolViewer shows 4JHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.