Crystal Structure of N-terminal region of yeast Atg7. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Nov 2011.
Explore 3RUJ in 3D Show helices and sheets RCSB PDB PDBe
3RUJ contains 12 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-6 | 2 | 1 |
| α-helix | 7 | 1 | |
| β-strand | 10 | 1 | 2 |
| β-strand | 13-17 | 5 | 3 |
| α-helix | 19-25 | 7 | |
| β-strand | 37-47 | 11 | 4 |
| β-strand | 57 | 1 | 5 |
| β-strand | 58-62 | 5 | 3 |
| α-helix | 64-67 | 4 | |
| β-strand | 77-87 | 11 | 4 |
| α-helix | 90-95 | 6 | |
| α-helix | 98-115 | 18 | |
| α-helix | 117-119 | 3 | |
| β-strand | 123-130 | 8 | 4 |
| β-strand | 135-146 | 12 | 4 |
| β-strand | 151-158 | 8 | 1 |
| α-helix | 165-174 | 10 | |
| β-strand | 180-183 | 4 | 1 |
| β-strand | 189-191 | 3 | 1 |
| α-helix | 194-200 | 7 | |
| β-strand | 202-206 | 5 | 1 |
| β-strand | 209 | 1 | 5 |
| β-strand | 216 | 1 | 2 |
| α-helix | 219-229 | 11 | |
| β-strand | 235-241 | 7 | 1 |
| β-strand | 248-256 | 9 | 1 |
| α-helix | 265-266 | 2 | |
| β-strand | 269-273 | 5 | 4 |
| α-helix | 274-275 | 2 | |
| β-strand | 284-287 | 4 | 4 |
| α-helix | 289-291 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like modifier-activating enzyme ATG7 | A | protein | 296 | Saccharomyces cerevisiae | P38862 (AlphaFold model) |
>3RUJ_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A) GSMSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQV PLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDIN KCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSK WVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKL LIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDP
Insights into noncanonical E1 enzyme activation from the structure of autophagic E1 Atg7 with Atg8. Hong, S.B., Kim, B.W., Lee, K.E. et al. Nat Struct Mol Biol (2011) 18:1323-1330. DOI 10.1038/nsmb.2165 · PubMed
Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3RUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.