3RW6: Nuclear RNA export factor TAP

Structure of nuclear RNA export factor TAP bound to CTE RNA. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Aug 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,786
Mol. weight: 101.59 kDa
Released: 10 Aug 2011

Explore 3RW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RW6 contains 37 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	120-124	5	1
α-helix	127-129	3
α-helix	132-141	10
β-strand	150-155	6	1
β-strand	158-163	6	1
α-helix	166-174	9
β-strand	180	1	2
β-strand	186	1	2
β-strand	190-193	4	1
α-helix	195-197	3
α-helix	198-201	4
α-helix	204-205	2
α-helix	206-218	13
β-strand	220-221	2	3
β-strand	226-228	3	3
α-helix	232-234	3
α-helix	236-240	5
α-helix	250-263	14
β-strand	269-271	3	3
α-helix	281-283	3
α-helix	286-289	4
β-strand	295-297	3	3
α-helix	306-312	7
β-strand	319-321	3	3
α-helix	328-330	3
α-helix	334-344	11
β-strand	350-351	2	3
β-strand	355	1	3
α-helix	356-359	4

Chain B: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	119-124	6	4
α-helix	127-129	3
α-helix	132-142	11
β-strand	150-155	6	4
β-strand	158-163	6	4
α-helix	166-174	9
α-helix	179	1
β-strand	180	1	5
α-helix	181	1
α-helix	185	1
β-strand	186	1	5
α-helix	187-188	2
β-strand	190-194	5	4
α-helix	195-197	3
α-helix	198-201	4
α-helix	204-205	2
α-helix	206-218	13
β-strand	220-221	2	6
α-helix	222-224	3
β-strand	226-228	3	6
α-helix	232-234	3
α-helix	236-240	5
α-helix	250-263	14
β-strand	269-271	3	6
α-helix	281-283	3
α-helix	286-289	4
β-strand	295-297	3	6
α-helix	306-311	6
β-strand	319-321	3	6
α-helix	328-330	3
α-helix	334-342	9
β-strand	350-351	2	6
β-strand	354-355	2	6
α-helix	356-358	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear RNA export factor 1	A, B	protein	267	Homo sapiens	Q9UBU9 (AlphaFold model)
constitutive transport element(CTE)of Mason-Pfizer monkey virus RNA	F, H	RNA	62

Sequence of entity 1 (A, B), FASTA

>3RW6_1 Nuclear RNA export factor 1 (chains A, B)
VRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYE
NTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLI
MSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNN
RLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQS
TYISAIRERFPKLLRLDGHELPPPIAF

Sequence of entity 2 (F, H), FASTA

>3RW6_2 constitutive transport element(CTE)of Mason-Pfizer monkey virus RNA (chains F, H)
GGCACUAACCUAAGACAGGAGGGCCGGGAAACCUGCCUAAUCCAAUGACGGGUAAUAGUG
UC

Primary citation

Structure-function studies of nucleocytoplasmic transport of retroviral genomic RNA by mRNA export factor TAP. Teplova, M., Wohlbold, L., Khin, N.W. et al. Nat Struct Mol Biol (2011) 18:990-998. DOI 10.1038/nsmb.2094 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…
1KOO 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 3RW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.