3S24: Human mRNA guanylyltransferase

Crystal structure of human mRNA guanylyltransferase. Determined by X-ray diffraction at 3.01 Å resolution. Released 15 Jun 2011.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 7
Atoms: 18,387
Mol. weight: 280.4 kDa
Released: 15 Jun 2011

Explore 3S24 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S24 contains 100 α-helices and 164 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	241-243	3	1
α-helix	247-261	15
β-strand	271-275	5	2
α-helix	281-285	5
β-strand	289-295	7	2
α-helix	296	1
β-strand	298-304	7	1
β-strand	310-314	5	1
β-strand	319-322	4	1
β-strand	328	1	3
β-strand	336	1	3
β-strand	340-351	12	1
β-strand	354-366	13	1
β-strand	367	1	4
β-strand	370	1	4
α-helix	372-374	3
α-helix	377-382	6
α-helix	383-389	7
α-helix	390-394	5
β-strand	409-412	4	1
β-strand	416-417	2	2
α-helix	418-424	7
β-strand	437-444	8	2
β-strand	451-459	9	2
α-helix	462-464	3
β-strand	466-476	11	5
β-strand	484-490	7	5
β-strand	492	1	6
β-strand	499-501	3	5
α-helix	507-509	3
β-strand	514-520	7	5
β-strand	523-529	7	5
β-strand	538	1	6
α-helix	539-550	12
α-helix	555-563	9

Chain B: 15 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	7
α-helix	248-261	14
β-strand	271-275	5	8
α-helix	278-281	4
α-helix	282-285	4
β-strand	289-292	4	8
α-helix	294-296	3
β-strand	298-304	7	7
β-strand	310-314	5	7
β-strand	319-321	3	7
β-strand	328	1	9
β-strand	336	1	9
β-strand	340-350	11	7
β-strand	355-366	12	7
β-strand	367	1	10
β-strand	370	1	10
α-helix	372-374	3
α-helix	377-384	8
α-helix	385-389	5
α-helix	390-397	8
β-strand	409-412	4	7
α-helix	413-414	2
β-strand	416-417	2	8
α-helix	418-421	4
α-helix	422-424	3
β-strand	440-444	5	8
α-helix	447-448	2
β-strand	451-459	9	8
β-strand	467-470	4	11
β-strand	472	1	12
β-strand	487-491	5	12
β-strand	492	1	13
β-strand	494-501	8	12
β-strand	514-520	7	11
β-strand	523-529	7	11
α-helix	536-537	2
β-strand	538	1	13
α-helix	539-549	11
α-helix	555-563	9

Chain C: 15 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	14
α-helix	247-261	15
β-strand	271-275	5	15
α-helix	280-285	6
β-strand	289-294	6	15
α-helix	295	1
β-strand	298-304	7	14
β-strand	310-313	4	14
β-strand	319-321	3	14
β-strand	328	1	16
β-strand	336	1	16
β-strand	340-351	12	14
β-strand	354-366	13	14
β-strand	367	1	17
β-strand	370	1	17
α-helix	372-374	3
α-helix	377-383	7
α-helix	384-389	6
α-helix	390-397	8
β-strand	409-412	4	14
α-helix	413-414	2
β-strand	416-417	2	15
α-helix	418-420	3
α-helix	421-424	4
β-strand	439-444	6	15
α-helix	447-448	2
β-strand	451-459	9	15
α-helix	462-464	3
β-strand	466-472	7	18
β-strand	488-491	4	18
β-strand	492	1	19
β-strand	494-500	7	18
β-strand	514-520	7	18
β-strand	523-529	7	18
α-helix	536-537	2
β-strand	538	1	19
α-helix	539-549	11
α-helix	555-563	9

Chain D: 18 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	20
α-helix	250-261	12
β-strand	271-275	5	21
α-helix	280-285	6
β-strand	289-292	4	21
α-helix	294	1
β-strand	295	1	22
α-helix	296	1
β-strand	298-304	7	20
β-strand	310-314	5	20
β-strand	319-321	3	20
β-strand	328	1	23
β-strand	336	1	23
β-strand	340-348	9	20
β-strand	357-366	10	20
β-strand	367	1	24
β-strand	370	1	24
α-helix	372-374	3
α-helix	377-383	7
α-helix	384-389	6
α-helix	390-397	8
α-helix	403-405	3
β-strand	409-412	4	20
α-helix	413-414	2
β-strand	416-417	2	21
α-helix	418-420	3
α-helix	421-425	5
β-strand	437	1	22
β-strand	440-444	5	21
α-helix	447-448	2
β-strand	451-459	9	21
β-strand	466-476	11	25
β-strand	484-490	7	25
β-strand	492	1	26
β-strand	499-502	4	25
α-helix	503-504	2
α-helix	507-510	4
β-strand	514-519	6	25
β-strand	524-530	7	25
α-helix	536-537	2
β-strand	538	1	26
α-helix	539-549	11
α-helix	555-562	8

Chain E: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	27
α-helix	247-261	15
β-strand	271-275	5	28
α-helix	280-285	6
β-strand	289-294	6	28
β-strand	298-304	7	27
β-strand	311-313	3	27
β-strand	319-321	3	27
β-strand	328	1	29
β-strand	336	1	29
β-strand	340-350	11	27
β-strand	355-366	12	27
β-strand	367	1	30
β-strand	370	1	30
α-helix	372-374	3
α-helix	377-388	12
α-helix	390-397	8
α-helix	403-405	3
β-strand	409-412	4	27
α-helix	413-414	2
β-strand	416-417	2	28
α-helix	418-420	3
β-strand	439-444	6	28
β-strand	451-459	9	28
α-helix	462-464	3
β-strand	466-474	9	31
β-strand	486-490	5	31
β-strand	492	1	32
β-strand	499-501	3	31
α-helix	508-510	3
β-strand	514-519	6	31
β-strand	524-529	6	31
β-strand	538	1	32
α-helix	539-550	12
α-helix	555-565	11

Chain F: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	39
α-helix	247-261	15
β-strand	272-275	4	40
α-helix	280-282	3
α-helix	283-286	4
β-strand	289-292	4	40
β-strand	298-304	7	39
β-strand	310-314	5	39
β-strand	319-321	3	39
β-strand	328	1	41
β-strand	336	1	41
β-strand	340-351	12	39
β-strand	354-366	13	39
β-strand	367	1	42
β-strand	370	1	42
α-helix	372-374	3
α-helix	377-383	7
α-helix	384-389	6
α-helix	390-397	8
α-helix	403-405	3
β-strand	409-412	4	39
α-helix	413-414	2
β-strand	416-417	2	40
α-helix	418-423	6
β-strand	440-444	5	40
α-helix	447-448	2
β-strand	452-459	8	40
α-helix	462-464	3
β-strand	466-473	8	43
β-strand	486-490	5	43
β-strand	492	1	44
β-strand	499-502	4	43
α-helix	505-510	6
β-strand	514-519	6	43
β-strand	524-529	6	43
α-helix	536-537	2
β-strand	538	1	44
α-helix	539-550	12
α-helix	555-563	9

Chain G: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	242-243	2	33
α-helix	248-261	14
β-strand	271-275	5	34
α-helix	280-285	6
β-strand	289-294	6	34
β-strand	298-304	7	33
β-strand	310-314	5	33
β-strand	319-321	3	33
β-strand	328	1	35
β-strand	336	1	35
α-helix	337	1
β-strand	340-349	10	33
β-strand	356-366	11	33
β-strand	367	1	36
β-strand	370	1	36
α-helix	372-374	3
α-helix	377-383	7
α-helix	384-389	6
α-helix	390-397	8
β-strand	409-412	4	33
α-helix	413-414	2
β-strand	416-417	2	34
β-strand	439-444	6	34
α-helix	447-448	2
β-strand	451-459	9	34
α-helix	462-464	3
β-strand	466-473	8	37
β-strand	487-490	4	37
β-strand	492	1	38
β-strand	499-501	3	37
β-strand	514-520	7	37
β-strand	523-529	7	37
β-strand	538	1	38
α-helix	539-550	12
α-helix	555-562	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mRNA-capping enzyme	A, B, C, D, E, F, G	protein	347	Homo sapiens	O60942 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>3S24_1 mRNA-capping enzyme (chains A, B, C, D, E, F, G)
GAIFLEGVTVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKP
YKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMII
DRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPF
SVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVD
FRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMR
QRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTALEHHHHHH

Primary citation

Structure of the guanylyltransferase domain of human mRNA capping enzyme. Chu, C., Das, K., Tyminski, J.R. et al. Proc Natl Acad Sci U S A (2011) 108:10104-10108. DOI 10.1073/pnas.1106610108 · PubMed

Other PDB entries of the same protein (UniProt O60942 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C46 1.6 Å, CRYSTAL STRUCTURE OF THE HUMAN RNA guanylyltransferase and 5'- phosphatase
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
8P4A 3.6 Å, Structural insights into human co-transcriptional capping - structure 1
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
8W8F 4.0 Å, human co-transcriptional RNA capping enzyme RNGTT-CMTR1

Browse structure collections

About this viewer

MolViewer shows 3S24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.