Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide. Determined by X-ray diffraction at 1.85 Å resolution. Released 2 Nov 2011.
Explore 3S8O in 3D Show helices and sheets RCSB PDB PDBe
3S8O contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 61 | 1 | 1 |
| α-helix | 67-74 | 8 | |
| β-strand | 82-87 | 6 | 1 |
| β-strand | 95-101 | 7 | 1 |
| β-strand | 104-109 | 6 | 1 |
| β-strand | 111-112 | 2 | 2 |
| β-strand | 118-119 | 2 | 2 |
| β-strand | 124-125 | 2 | 2 |
| α-helix | 128-134 | 7 | |
| β-strand | 149-150 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Growth factor receptor-bound protein 2 | A | protein | 117 | Homo sapiens | P62993 (AlphaFold model) |
| pYAc6cN | B | protein | 5 |
>3S8O_1 Growth factor receptor-bound protein 2 (chains A) IEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLR DGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQAHHHHHH
>3S8O_2 pYAc6cN (chains B) XYANX
Protein-ligand interactions: thermodynamic effects associated with increasing nonpolar surface area. Myslinski, J.M., Delorbe, J.E., Clements, J.H. et al. J Am Chem Soc (2011) 133:18518-18521. DOI 10.1021/ja2068752 · PubMed
Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3S8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.