3S8W: D2 domain of human IFNAR2

D2 domain of human IFNAR2. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Aug 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,992
Mol. weight: 36.21 kDa
Released: 31 Aug 2011

Explore 3S8W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S8W contains 7 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	109-110	2
β-strand	111-116	6	1
β-strand	121-126	6	1
β-strand	141-146	6	2
β-strand	151-154	4	2
β-strand	166-170	5	1
α-helix	173-174	2
β-strand	178-185	8	2
α-helix	195-198	4
β-strand	199-202	4	2

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	108-110	3
β-strand	111-116	6	3
β-strand	121-126	6	3
β-strand	140-147	8	2
β-strand	150-154	5	2
β-strand	166-170	5	3
β-strand	178-186	9	2
α-helix	195-197	3
β-strand	198-202	5	2

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	108-110	3
β-strand	111-116	6	4
β-strand	121-127	7	4
β-strand	140-147	8	5
β-strand	150-154	5	5
β-strand	157-158	2	1
β-strand	164-170	7	4
β-strand	178-186	9	5
α-helix	195-198	4
β-strand	199-202	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon alpha/beta receptor 2	A, B, C	protein	105	Homo sapiens	P48551 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3S8W_1 Interferon alpha/beta receptor 2 (chains A, B, C)
ADPDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG
NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPP

Primary citation

Structural linkage between ligand discrimination and receptor activation by type I interferons. Thomas, C., Moraga, I., Levin, D. et al. Cell (2011) 146:621-632. DOI 10.1016/j.cell.2011.06.048 · PubMed

Other PDB entries of the same protein (UniProt P48551 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S9D 2.0 Å, binary complex between IFNa2 and IFNAR2
3SE4 3.5 Å, human IFNw-IFNAR ternary complex
3SE3 4.0 Å, human IFNa2-IFNAR ternary complex
1N6U NMR structure of the interferon-binding ectodomain of the human interferon receptor
1N6V Average structure of the interferon-binding ectodomain of the human type I interferon…
2HYM NMR based Docking Model of the Complex between the Human Type I Interferon Receptor and…
2KZ1 Inter-molecular interactions in a 44 kDa interferon-receptor complex detected by…
2LAG Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of…

Browse structure collections

About this viewer

MolViewer shows 3S8W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.