Crystal structure of the complex between the conserved cell polarity proteins Inscuteable and LGN. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Nov 2011.
Explore 3SF4 in 3D Show helices and sheets RCSB PDB PDBe
3SF4 contains 57 α-helices and 8 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-16 | 3 | |
| α-helix | 17-29 | 13 | |
| α-helix | 33-46 | 14 | |
| α-helix | 51-67 | 17 | |
| α-helix | 71-87 | 17 | |
| α-helix | 91-107 | 17 | |
| α-helix | 111-128 | 18 | |
| α-helix | 131-150 | 20 | |
| α-helix | 165-187 | 23 | |
| α-helix | 191-208 | 18 | |
| β-strand | 210 | 1 | 1 |
| α-helix | 211-227 | 17 | |
| α-helix | 231-247 | 17 | |
| α-helix | 251-267 | 17 | |
| α-helix | 271-287 | 17 | |
| α-helix | 291-307 | 17 | |
| α-helix | 311-328 | 18 | |
| α-helix | 331-347 | 17 | |
| α-helix | 351-369 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-28 | 7 | |
| α-helix | 33-46 | 14 | |
| α-helix | 51-67 | 17 | |
| α-helix | 71-87 | 17 | |
| α-helix | 91-108 | 18 | |
| α-helix | 111-127 | 17 | |
| α-helix | 131-151 | 21 | |
| α-helix | 165-187 | 23 | |
| α-helix | 191-208 | 18 | |
| β-strand | 210 | 1 | 1 |
| α-helix | 211-227 | 17 | |
| α-helix | 231-246 | 16 | |
| α-helix | 251-267 | 17 | |
| α-helix | 271-287 | 17 | |
| α-helix | 291-307 | 17 | |
| α-helix | 311-328 | 18 | |
| α-helix | 331-347 | 17 | |
| α-helix | 351-369 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-30 | 14 | |
| α-helix | 33-46 | 14 | |
| α-helix | 51-67 | 17 | |
| α-helix | 71-87 | 17 | |
| α-helix | 91-107 | 17 | |
| α-helix | 111-127 | 17 | |
| α-helix | 131-151 | 21 | |
| α-helix | 165-188 | 24 | |
| α-helix | 191-208 | 18 | |
| α-helix | 211-228 | 18 | |
| α-helix | 231-248 | 18 | |
| α-helix | 251-268 | 18 | |
| α-helix | 271-287 | 17 | |
| α-helix | 291-307 | 17 | |
| α-helix | 311-328 | 18 | |
| α-helix | 331-347 | 17 | |
| α-helix | 351-366 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-35 | 10 | |
| β-strand | 45-48 | 4 | 2 |
| α-helix | 56-58 | 3 | |
| β-strand | 62-65 | 4 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-35 | 10 | |
| β-strand | 45-47 | 3 | 3 |
| β-strand | 63-65 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| G-protein-signaling modulator 2 | A, B, C | protein | 406 | Homo sapiens | P81274 (AlphaFold model) |
| Protein inscuteable homolog | D, E, F | protein | 52 | Homo sapiens | Q1MX18 (AlphaFold model) |
>3SF4_1 G-protein-signaling modulator 2 (chains A, B, C) GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYL HDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISREL NDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTAL GDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFL GEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEL NDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVL GLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEK
>3SF4_2 Protein inscuteable homolog (chains D, E, F) GPLGSMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPG
Structural basis for interaction between the conserved cell polarity proteins Inscuteable and Leu-Gly-Asn repeat-enriched protein (LGN). Yuzawa, S., Kamakura, S., Iwakiri, Y. et al. Proc Natl Acad Sci U S A (2011) 108:19210-19215. DOI 10.1073/pnas.1110951108 · PubMed
Other PDB entries of the same protein (UniProt P81274 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3SF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.