3SHB: PHD Domain of UHRF1

Crystal Structure of PHD Domain of UHRF1. Determined by X-ray diffraction at 1.8 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 644
Mol. weight: 10.2 kDa
Ligands: ZN
Released: 24 Aug 2011

Explore 3SHB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SHB contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	331	1	1
α-helix	340-342	3
β-strand	343-345	3	1
α-helix	346	1
β-strand	352-354	3	1
α-helix	361-362	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A	protein	77	Homo sapiens	Q96T88 (AlphaFold model)
Histone H3 peptide	B	protein	12	Homo sapiens

Sequence of entity 1 (A), FASTA

>3SHB_1 E3 ubiquitin-protein ligase UHRF1 (chains A)
GPLGSPEFSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPL
SSVPSEDEWYCPECRND

Sequence of entity 2 (B), FASTA

>3SHB_2 Histone H3 peptide (chains B)
ARTKQTARKSTG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2. Hu, L., Li, Z., Wang, P. et al. Cell Res (2011). DOI 10.1038/cr.2011.124 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1

Browse structure collections

About this viewer

MolViewer shows 3SHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.