3SJB: S. cerevisiae Get3 in the open state

Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic domain. Determined by X-ray diffraction at 3.3 Å resolution. Released 6 Jul 2011.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 5,823
Mol. weight: 103.95 kDa
Ligands: ZN, PO4
Released: 6 Jul 2011

Explore 3SJB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SJB contains 34 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	20-24	5	1
α-helix	31-45	15
β-strand	51-55	5	1
α-helix	62-66	5
β-strand	75-76	2	1
α-helix	77	1
β-strand	83-87	5	1
α-helix	90-97	8
α-helix	136-156	21
β-strand	162-166	5	1
α-helix	175-177	3
α-helix	215-230	16
β-strand	236-243	8	1
α-helix	246-261	16
β-strand	265-274	10	1
α-helix	277-279	3
α-helix	286-303	18
β-strand	310-315	6	1
α-helix	324-331	8
α-helix	332-334	3
α-helix	340-353	14

Chain B: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
β-strand	20-24	5	2
α-helix	31-45	15
β-strand	51-55	5	2
α-helix	62-66	5
β-strand	75-76	2	2
α-helix	77	1
β-strand	83-87	5	2
α-helix	90-100	11
α-helix	125-129	5
α-helix	136-156	21
β-strand	162-166	5	2
α-helix	175-178	4
α-helix	179-188	10
α-helix	218-230	13
β-strand	236-243	8	2
α-helix	246-262	17
β-strand	265-274	10	2
α-helix	277-279	3
α-helix	286-303	18
β-strand	310-315	6	2
α-helix	324-331	8
α-helix	332-334	3
α-helix	340-353	14

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	38-56	19
α-helix	65-98	34

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	37-56	20
α-helix	65-106	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A, B	protein	362	Saccharomyces cerevisiae	Q12154 (AlphaFold model)
Golgi to ER traffic protein 1	C, D	protein	93	Saccharomyces cerevisiae	P53192 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SJB_1 ATPase GET3 (chains A, B)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKELEHHHH
HH

Sequence of entity 2 (C, D), FASTA

>3SJB_2 Golgi to ER traffic protein 1 (chains C, D)
MQYTNKYHEKWISKFAPGNELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDS
LDKEINNLKDEIQSENKAFQAHLHKLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
PO4	Phosphate ion	O4 P	4

Primary citation

Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex. Stefer, S., Reitz, S., Wang, F. et al. Science (2011) 333:758-762. DOI 10.1126/science.1207125 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment

Browse structure collections

About this viewer

MolViewer shows 3SJB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.