3SJD: S. cerevisiae Get3 with bound ADP-Mg2+

Crystal structure of S. cerevisiae Get3 with bound ADP-Mg2+ in complex with Get2 cytosolic domain. Determined by X-ray diffraction at 4.6 Å resolution. Released 13 Jul 2011.

Method: X-ray diffraction
Resolution: 4.6 Å
Organism: Saccharomyces cerevisiae
Chains: 5
Atoms: 7,387
Mol. weight: 133.86 kDa
Ligands: ADP, MG, ZN
Released: 13 Jul 2011

Explore 3SJD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SJD contains 41 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	1
α-helix	32-44	13
β-strand	51-55	5	1
α-helix	61-66	6
β-strand	75-76	2	1
β-strand	78	1	2
β-strand	80	1	2
β-strand	83-87	5	1
α-helix	136-154	19
β-strand	163-164	2	1
α-helix	174-178	5
α-helix	179-194	16
α-helix	211-230	20
β-strand	236-241	6	1
α-helix	246-260	15
β-strand	268-270	3	1
α-helix	286-304	19
β-strand	310-312	3	1
α-helix	324-331	8
α-helix	332-334	3
α-helix	347-349	3

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	3
α-helix	32-44	13
β-strand	51-54	4	3
α-helix	61-66	6
β-strand	75-76	2	3
β-strand	78	1	4
β-strand	80	1	4
β-strand	83-86	4	3
α-helix	136-154	19
β-strand	163-166	4	3
α-helix	174-177	4
α-helix	178-190	13
α-helix	213-231	19
β-strand	236-241	6	3
α-helix	246-260	15
β-strand	268-270	3	3
α-helix	286-304	19
β-strand	310-312	3	3
α-helix	324-331	8
α-helix	332-334	3
α-helix	340-343	4
α-helix	347-349	3

Chain C: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
β-strand	20-24	5	5
α-helix	32-44	13
β-strand	51-55	5	5
α-helix	61-66	6
β-strand	75-76	2	5
β-strand	78	1	6
β-strand	80	1	6
β-strand	83-87	5	5
α-helix	136-154	19
β-strand	163-166	4	5
α-helix	174-177	4
α-helix	178-188	11
α-helix	212-231	20
β-strand	236-241	6	5
α-helix	246-260	15
β-strand	268-270	3	5
α-helix	286-304	19
β-strand	310-312	3	5
α-helix	324-331	8
α-helix	332-334	3
α-helix	347-349	3

Chains D and E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19
α-helix	26-33	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase GET3	A, B, C	protein	362	Saccharomyces cerevisiae	Q12154 (AlphaFold model)
Golgi to ER traffic protein 2	D, E	protein	46	Saccharomyces cerevisiae	P40056 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>3SJD_1 ATPase GET3 (chains A, B, C)
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKELEHHHH
HH

Sequence of entity 2 (D, E), FASTA

>3SJD_2 Golgi to ER traffic protein 2 (chains D, E)
MKHHHHHHPMGSELTEAEKRRLLRERRQKKFSNGGASSRLNKITGW

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	3
MG	Magnesium ion	Mg	3
ZN	Zinc ion	Zn	2

Primary citation

Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex. Stefer, S., Reitz, S., Wang, F. et al. Science (2011) 333:758-762. DOI 10.1126/science.1207125 · PubMed

Other PDB entries of the same protein (UniProt Q12154 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WOJ 1.99 Å, ADP-AlF4 complex of S. cerevisiae GET3
4XTR 2.05 Å, Structure of Get3 bound to the transmembrane domain of Pep12
3ZS9 2.1 Å, S. cerevisiae Get3-ADP-AlF4- complex with a cytosolic Get2 fragment
3H84 2.3 Å, Crystal structure of GET3
4XVU 2.35 Å, Structure of Get3 bound to the transmembrane domain of Nyv1
4XWO 2.75 Å, Structure of Get3 bound to the transmembrane domain of Sec22
3A36 2.8 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
5BW8 2.8 Å, 2.8 A crystal structure of a Get3-Get4-Get5 intermediate complex from S.cerevisiae
3A37 3.0 Å, Structural insight into the membrane insertion of tail-anchored proteins by Get3
3B2E 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open conformation in complex with Get1…
3SJA 3.0 Å, Crystal structure of S. cerevisiae Get3 in the open state in complex with Get1 cytosolic…
3ZS8 3.0 Å, S. cerevisiae Get3 complexed with a cytosolic Get1 fragment

Browse structure collections

About this viewer

MolViewer shows 3SJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.