3SNS: Lipoprotein 34

Crystal structure of the C-terminal domain of Escherichia coli lipoprotein BamC. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Aug 2011.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,028
Mol. weight: 12.93 kDa
Released: 24 Aug 2011

Explore 3SNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SNS contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	230-234	5	1
β-strand	240-244	5	1
α-helix	248-261	14
β-strand	264-270	7	1
α-helix	271-273	3
β-strand	275-280	6	1
α-helix	282-284	3
α-helix	285-291	7
α-helix	298-299	2
β-strand	301-310	10	1
β-strand	313-319	7	1
α-helix	324	1
β-strand	325	1	1
α-helix	326-327	2
α-helix	328-342	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein 34	A	protein	120	Escherichia coli	P0A903 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SNS_1 Lipoprotein 34 (chains A)
ASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPL
SDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS

Primary citation

Crystallographic analysis of the C-terminal domain of the Escherichia coli lipoprotein BamC. Kim, K.H., Aulakh, S., Tan, W. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:1350-1358. DOI 10.1107/S174430911103363X · PubMed

Other PDB entries of the same protein (UniProt P0A903 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YH5 1.25 Å, Structure of the C-terminal domain of BamC
2YH6 1.55 Å, Structure of the N-terminal domain of BamC from E. coli
9CNW 2.6 Å, CryoEM structure of the APO-BAM complex in DDM detergent
9HG6 2.73 Å, BAM-SurA complex in the swing-in state
9HG5 2.82 Å, BAM-SurA complex in the swing-in state with full length BamC resolved
9HG7 2.83 Å, BAM-SurA complex in the swing-out state
9HG9 2.88 Å, BAM-SurA-darobactin complex in the swing-in state
3TGO 2.9 Å, Crystal structure of the E. coli BamCD complex
5D0O 2.9 Å, BamABCDE complex, outer membrane beta barrel assembly machinery entire complex
8PZV 2.9 Å, Wait Complex: BAM bound Darobactin-B and Extended SurA
9HG8 2.9 Å, BAM-SurA complex in the swing-out state with BamC resolved
8ADG 3.0 Å, Cryo-EM structure of Darobactin 22 bound BAM complex

Browse structure collections

About this viewer

MolViewer shows 3SNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.