Crystal structure of the C-terminal domain of Escherichia coli lipoprotein BamC. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Aug 2011.
Explore 3SNS in 3D Show helices and sheets RCSB PDB PDBe
3SNS contains 8 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 230-234 | 5 | 1 |
| β-strand | 240-244 | 5 | 1 |
| α-helix | 248-261 | 14 | |
| β-strand | 264-270 | 7 | 1 |
| α-helix | 271-273 | 3 | |
| β-strand | 275-280 | 6 | 1 |
| α-helix | 282-284 | 3 | |
| α-helix | 285-291 | 7 | |
| α-helix | 298-299 | 2 | |
| β-strand | 301-310 | 10 | 1 |
| β-strand | 313-319 | 7 | 1 |
| α-helix | 324 | 1 | |
| β-strand | 325 | 1 | 1 |
| α-helix | 326-327 | 2 | |
| α-helix | 328-342 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lipoprotein 34 | A | protein | 120 | Escherichia coli | P0A903 (AlphaFold model) |
>3SNS_1 Lipoprotein 34 (chains A) ASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPL SDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFS
Crystallographic analysis of the C-terminal domain of the Escherichia coli lipoprotein BamC. Kim, K.H., Aulakh, S., Tan, W. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2011) 67:1350-1358. DOI 10.1107/S174430911103363X · PubMed
Other PDB entries of the same protein (UniProt P0A903 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3SNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.