3SOU: UHRF1 PHD finger

Structure of UHRF1 PHD finger in complex with histone H3 1-9 peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 3 Aug 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,328
Mol. weight: 18.49 kDa
Ligands: ZN
Released: 3 Aug 2011

Explore 3SOU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SOU contains 8 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	331	1	1
α-helix	340-342	3
β-strand	343-345	3	1
β-strand	352-354	3	1
α-helix	361-362	2
α-helix	377-379	3

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	331	1	2
α-helix	340-342	3
β-strand	343-345	3	2
α-helix	346	1
β-strand	352-354	3	2
α-helix	355-357	3
α-helix	361-362	2
α-helix	377-379	3

Chains D and E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A, B	protein	70	Homo sapiens	Q96T88 (AlphaFold model)
Histone H3	D, E	protein	9	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3SOU_1 E3 ubiquitin-protein ligase UHRF1 (chains A, B)
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE
WYCPECRNDA

Sequence of entity 2 (D, E), FASTA

>3SOU_2 Histone H3 (chains D, E)
ARTKQTARK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Primary citation

PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression. Rajakumara, E., Wang, Z., Ma, H. et al. Mol Cell (2011) 43:275-284. DOI 10.1016/j.molcel.2011.07.006 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1

Browse structure collections

About this viewer

MolViewer shows 3SOU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.