E. coli trp aporepressor. Determined by X-ray diffraction at 1.67 Å resolution. Released 20 Jul 2011.
Explore 3SSW in 3D Show helices and sheets RCSB PDB PDBe
3SSW contains 12 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-31 | 23 | |
| α-helix | 35-42 | 8 | |
| α-helix | 45-63 | 19 | |
| α-helix | 68-75 | 8 | |
| α-helix | 79-91 | 13 | |
| α-helix | 94-104 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Trp operon repressor | N, R | protein | 107 | Escherichia coli | P0A881 (AlphaFold model) |
>3SSW_1 Trp operon repressor (chains N, R) AQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEEL LRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
Environment-dependent long-range structural distortion in a temperature-sensitive point mutant. Carey, J., Benoff, B., Harish, B. et al. Protein Sci (2012) 21:63-74. DOI 10.1002/pro.759 · PubMed
Other PDB entries of the same protein (UniProt P0A881 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3SSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.