3T5X: PCID2:DSS1 Structure

Name: PDB 3T5X: PCID2:DSS1 Structure
Published: 2012-02-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

PCID2:DSS1 Structure. Determined by X-ray diffraction at 2.12 Å resolution. Released 22 Feb 2012.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,894
Mol. weight: 32.01 kDa
Released: 22 Feb 2012

Explore 3T5X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T5X contains 16 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	206-222	17
α-helix	226-239	14
α-helix	245-261	17
β-strand	265-266	2	1
α-helix	267	1
α-helix	268-273	6
α-helix	277-279	3
α-helix	280-288	9
α-helix	291-300	10
α-helix	302-308	7
α-helix	311-315	5
α-helix	317-333	17
β-strand	337-339	3	2
α-helix	340-349	10
α-helix	357-370	14
β-strand	375-378	4	2
β-strand	383-386	4	2
α-helix	395-397	3

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	39-40	2	1
α-helix	42-44	3
α-helix	51-62	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PCI domain-containing protein 2	A	protein	203	Homo sapiens	Q5JVF3 (AlphaFold model)
26S proteasome complex subunit DSS1	B	protein	70	Homo sapiens	P60896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3T5X_1 PCI domain-containing protein 2 (chains A)
GSHMKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRSSQKNKRMILIYLL
PVKMLLGHMPTVELLKKYHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFLILEK
LKIITYRNLFKKVYLLLKTHQLSLDAFLVALKFMQVEDVDIDEVQCILANLIYMGHVKGY
ISHQHQKLVVSKQNPFPPLSTVC

Sequence of entity 2 (B), FASTA

>3T5X_2 26S proteasome complex subunit DSS1 (chains B)
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS

Primary citation

Structural basis for the assembly and nucleic acid binding of the TREX-2 transcription-export complex. Ellisdon, A.M., Dimitrova, L., Hurt, E. et al. Nat Struct Mol Biol (2012) 19:328-336. DOI 10.1038/nsmb.2235 · PubMed

Other PDB entries of the same protein (UniProt Q5JVF3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RV1 2.62 Å, Cryo-EM structure of the human UAP56-RNA - SAC3D1-PCID2-SEM1 complex
9DLP 2.79 Å, Cryo-EM structure of human TREX-2 complex bound to DDX39B(UAP56)
9T6L 2.9 Å, Cryo-EM structure of the human LENG8-PCID2-DSS1 complex bound to UAP56 and RRP1B
9DLV 2.97 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to DDX39B(UAP56)
9T6N 3.0 Å, Cryo-EM structure of the human GANP-PCID2-DSS1 complex bound to UAP56
9DLR 3.08 Å, Cryo-EM structure of the human TREX-2.1 complex (LENG8/PCID2/DSS1) bound to the…
9UPC 3.14 Å, Structure of human TREX-2
9UPB 3.41 Å, Structure of the human TREX-2 bound to UAP56
28WZ 3.5 Å, Cryo-EM structure of the human LENG8-PCID2-SEM1 complex
8R7J 3.5 Å, Cryo-EM structure of the human TREX-2 complex
8R7K 3.5 Å, Cryo-EM structure of the human UAP56 - TREX-2 complex
28WY 3.6 Å, Cryo-EM structure of the human SAC3D1-PCID2-SEM1 complex

Browse structure collections

About this viewer

MolViewer shows 3T5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.