3T6R: UHRF1

Structure of UHRF1 in complex with unmodified H3 N-terminal tail. Determined by X-ray diffraction at 1.95 Å resolution. Released 23 Nov 2011.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,215
Mol. weight: 17.57 kDa
Ligands: ZN, MG
Released: 23 Nov 2011

Explore 3T6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T6R contains 8 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	299-302	4
β-strand	318	1	1
α-helix	327-329	3
β-strand	330-332	3	1
α-helix	333	1
β-strand	339-341	3	1
α-helix	348-349	2

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	327-329	3
β-strand	330-332	3	2
α-helix	333	1
β-strand	339-341	3	2
α-helix	342-344	3
α-helix	348-349	2

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF1	A, B	protein	72	Homo sapiens	Q96T88 (AlphaFold model)
Histone H3.1t N-terminal peptide	D	protein	7	Homo sapiens	Q16695 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3T6R_1 E3 ubiquitin-protein ligase UHRF1 (chains A, B)
GSAPEFGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSV
PSEDEWYCPECR

Sequence of entity 2 (D), FASTA

>3T6R_2 Histone H3.1t N-terminal peptide (chains D)
ARTKQTA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	1

Primary citation

UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail. Xie, S., Jakoncic, J., Qian, C.M. J Mol Biol (2012) 415:318-328. DOI 10.1016/j.jmb.2011.11.012 · PubMed

Other PDB entries of the same protein (UniProt Q96T88 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W92 1.3 Å, Human UHRF1 TTD domain
6VYJ 1.39 Å, Human UHRF1 TTD domain in complex with a fragment
3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
3ZVZ 1.45 Å, PHD finger of human UHRF1
7FB7 1.45 Å, Crystal structure of human UHRF1 TTD in complex with 5-amino-2,4-dimethylpyridine
8XV6 1.6 Å, Crystal structure of PHD domain of UHRF1 in complex with mStella peptide (residues 85-119)
6B9M 1.68 Å, Crystal structure of UHRF1 TTD domain in complex with the polybasic region
6IIW 1.7 Å, Crystal structure of human UHRF1 PHD finger in complex with PAF15
3BI7 1.7 Å, Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
5YYA 1.7 Å, Crystal structure of Tandem Tudor Domain of human UHRF1
6VCS 1.7 Å, SRA domain of UHRF1 in complex with DNA
3FL2 1.75 Å, Crystal structure of the ring domain of the E3 ubiquitin-protein ligase UHRF1

Browse structure collections

About this viewer

MolViewer shows 3T6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.