Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the autophagy pathway. Determined by X-ray diffraction at 2.25 Å resolution. Released 23 Nov 2011.
Explore 3T7E in 3D Show helices and sheets RCSB PDB PDBe
3T7E contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 294-312 | 19 | |
| α-helix | 320-323 | 4 | |
| β-strand | 326-330 | 5 | 1 |
| α-helix | 334-345 | 12 | |
| β-strand | 350-354 | 5 | 1 |
| β-strand | 358 | 1 | 2 |
| α-helix | 363-366 | 4 | |
| α-helix | 372-374 | 3 | |
| β-strand | 378 | 1 | 2 |
| α-helix | 379-390 | 12 | |
| β-strand | 395-399 | 5 | 1 |
| α-helix | 404-405 | 2 | |
| α-helix | 413-429 | 17 | |
| β-strand | 432-435 | 4 | 1 |
| β-strand | 439 | 1 | 3 |
| α-helix | 440-442 | 3 | |
| α-helix | 444-452 | 9 | |
| β-strand | 456-462 | 7 | 1 |
| β-strand | 466-471 | 6 | 1 |
| α-helix | 500-502 | 3 | |
| β-strand | 505 | 1 | 3 |
| α-helix | 512-529 | 18 | |
| α-helix | 532-534 | 3 | |
| β-strand | 539-540 | 2 | 4 |
| β-strand | 543-544 | 2 | 4 |
| β-strand | 548-552 | 5 | 1 |
| β-strand | 557-561 | 5 | 1 |
| α-helix | 564-566 | 3 | |
| α-helix | 574-583 | 10 | |
| α-helix | 585-593 | 9 | |
| α-helix | 595-602 | 8 | |
| α-helix | 604-612 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-like modifier-activating enzyme ATG7 | A | protein | 344 | Saccharomyces cerevisiae | P38862 (AlphaFold model) |
>3T7E_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A) GSSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAW GVRKITFVDNGTVSYSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMI GHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDS YLVMRHGNRDEQSSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELM TSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWE FVKKALEHPLYLEEISGLSVIKQEVERLGNDVFEWEDDESDEIA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Atg8 transfer from atg7 to atg3: a distinctive e1-e2 architecture and mechanism in the autophagy pathway. Taherbhoy, A.M., Tait, S.W., Kaiser, S.E. et al. Mol Cell (2011) 44:451-461. DOI 10.1016/j.molcel.2011.08.034 · PubMed
Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3T7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.