3T7G: Ubiquitin-like modifier-activating enzyme ATG7

Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the autophagy pathway. Determined by X-ray diffraction at 2.08 Å resolution. Released 23 Nov 2011.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 4,766
Mol. weight: 70.92 kDa
Released: 23 Nov 2011

Explore 3T7G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3T7G contains 24 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
β-strand	10	1	2
β-strand	13-17	5	3
α-helix	19-31	13
β-strand	37-46	10	4
β-strand	57	1	5
β-strand	58-62	5	3
α-helix	64-67	4
α-helix	73-74	2
β-strand	78-87	10	4
α-helix	90-95	6
α-helix	98-115	18
α-helix	117-119	3
β-strand	123-130	8	4
β-strand	135-146	12	4
β-strand	151-157	7	1
α-helix	159-164	6
α-helix	165-174	10
β-strand	180-183	4	1
β-strand	189-191	3	1
α-helix	194-200	7
β-strand	202-206	5	1
β-strand	209	1	5
β-strand	216	1	2
α-helix	219-229	11
β-strand	235-241	7	1
β-strand	248-256	9	1
α-helix	259-261	3
β-strand	269-273	5	4
α-helix	274-275	2
β-strand	284-287	4	4

Chain B: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	6
β-strand	10	1	7
β-strand	13-17	5	8
α-helix	19-28	10
β-strand	37-46	10	9
β-strand	57	1	10
β-strand	58-62	5	8
α-helix	64-67	4
β-strand	78-87	10	9
α-helix	90-95	6
α-helix	98-113	16
α-helix	117-119	3
β-strand	123-130	8	9
β-strand	135-146	12	9
β-strand	152-157	6	6
α-helix	159-162	4
α-helix	165-174	10
β-strand	180-183	4	6
β-strand	189-191	3	6
α-helix	194-200	7
β-strand	202-206	5	6
β-strand	209	1	10
β-strand	216	1	7
α-helix	219-229	11
β-strand	235-241	7	6
β-strand	248-255	8	6
β-strand	269-273	5	9
α-helix	274-275	2
β-strand	284-287	4	9

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	132-139	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	135-138	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like modifier-activating enzyme ATG7	A, B	protein	291	Saccharomyces cerevisiae	P38862 (AlphaFold model)
Autophagy-related protein 3	C, D	protein	17	Saccharomyces cerevisiae	P40344 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3T7G_1 Ubiquitin-like modifier-activating enzyme ATG7 (chains A, B)
GSMSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQV
PLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDIN
KCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSK
WVCILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKL
LIIRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLS

Sequence of entity 2 (C, D), FASTA

>3T7G_2 Autophagy-related protein 3 (chains C, D)
SIDDIDELIQDMEIKEE

Primary citation

Atg8 transfer from atg7 to atg3: a distinctive e1-e2 architecture and mechanism in the autophagy pathway. Taherbhoy, A.M., Tait, S.W., Kaiser, S.E. et al. Mol Cell (2011) 44:451-461. DOI 10.1016/j.molcel.2011.08.034 · PubMed

Other PDB entries of the same protein (UniProt P38862 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T7H 1.6 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
4GSJ 1.7 Å, Crystal structure of Atg7 NTD K14A F16A D18A mutant
3T7F 1.89 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3RUI 1.91 Å, Crystal structure of Atg7C-Atg8 complex
3VH3 2.0 Å, Crystal structure of Atg7CTD-Atg8 complex
3RUJ 2.1 Å, Crystal Structure of N-terminal region of yeast Atg7
5YEC 2.15 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex in form II
3T7E 2.25 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
3VH4 2.65 Å, Crystal structure of Atg7CTD-Atg8-MgATP complex
4GSL 2.7 Å, Crystal structure of an Atg7-Atg3 crosslinked complex
4GSK 2.9 Å, Crystal structure of an Atg7-Atg10 crosslinked complex
3VH1 3.0 Å, Crystal structure of Saccharomyces cerevisiae Atg7 (1-595)

Browse structure collections

About this viewer

MolViewer shows 3T7G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.