3TAC: Liprin-alpha/CASK complex

Crystal Structure of the Liprin-alpha/CASK complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Oct 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,035
Mol. weight: 79.91 kDa
Released: 12 Oct 2011

Explore 3TAC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3TAC contains 52 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	8-11	4
β-strand	12-20	9	1
β-strand	24-31	8	1
β-strand	37-44	8	1
α-helix	45-49	5
α-helix	56-68	13
β-strand	74	1	2
β-strand	77-83	7	1
β-strand	86-92	7	1
α-helix	93-94	2
β-strand	98	1	2
α-helix	99-108	10
β-strand	111	1	3
α-helix	115-134	20
β-strand	137-138	2	4
α-helix	144-146	3
β-strand	147-149	3	2
α-helix	156-157	2
β-strand	158-160	3	2
α-helix	163-165	3
β-strand	167-168	2	4
α-helix	169-170	2
β-strand	175	1	5
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	5
α-helix	199-214	16
α-helix	223-232	10
α-helix	239-242	4
α-helix	247-256	10
α-helix	265-266	2
α-helix	267-271	5
α-helix	274-277	4
α-helix	279-282	4
α-helix	289-300	12
α-helix	307-311	5

Chain B: 29 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	874-890	17
α-helix	895-897	3
α-helix	900-905	6
α-helix	906-910	5
α-helix	915-924	10
α-helix	928-932	5
α-helix	936-938	3
α-helix	939-943	5
α-helix	948-964	17
α-helix	966-969	4
α-helix	971-973	3
β-strand	983	1	3
α-helix	984-994	11
α-helix	1021-1023	3
α-helix	1024-1028	5
α-helix	1029-1031	3
α-helix	1035-1037	3
α-helix	1038-1043	6
α-helix	1048-1051	4
α-helix	1056-1057	2
α-helix	1058-1062	5
α-helix	1068-1083	16
α-helix	1088-1097	10
α-helix	1105-1107	3
α-helix	1110-1119	10
α-helix	1123-1126	4
α-helix	1127-1129	3
α-helix	1136-1141	6
α-helix	1147-1153	7
α-helix	1161-1178	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peripheral plasma membrane protein CASK	A	protein	361	Homo sapiens	O14936 (AlphaFold model)
Liprin-alpha-2	B	protein	334	Homo sapiens	O75334 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3TAC_1 Peripheral plasma membrane protein CASK (chains A)
MHHHHHHSSGLVPRGSMADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVD
VAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIV
KRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFG
VAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKE
RLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAY
KIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAE
R

Sequence of entity 2 (B), FASTA

>3TAC_2 Liprin-alpha-2 (chains B)
GPGSEFGKLGTQAEKDRRLKKKHELLEEARRKGLPFAQWDGPTVVAWLELWLGMPAWYVA
ACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGN
VWVTHEEMENLAAQAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRS
YFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRREASQ
HEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQ
NTQARQILEREYNNLLALGTERRLDESDDKNFRR

Primary citation

Liprin-mediated large signaling complex organization revealed by the liprin-alpha/CASK and liprin-alpha/liprin-beta complex structures. Wei, Z., Zheng, S., Spangler, S.A. et al. Mol Cell (2011) 43:586-598. DOI 10.1016/j.molcel.2011.07.021 · PubMed

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KGD 1.31 Å, Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NH9 1.85 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
1KWA 1.93 Å, Human cask/lin-2 PDZ domain
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
3MFS 2.1 Å, CASK-4M CaM Kinase Domain, AMPPNP
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25

Browse structure collections

About this viewer

MolViewer shows 3TAC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.