A Neutral Diphosphate Mimic Crosslinks the Active Site of Human O-GlcNAc Transferase. Determined by X-ray diffraction at 1.88 Å resolution. Released 16 Nov 2011.
Explore 3TAX in 3D Show helices and sheets RCSB PDB PDBe
3TAX contains 88 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 316-330 | 15 | |
| α-helix | 333-346 | 14 | |
| α-helix | 351-363 | 13 | |
| α-helix | 367-380 | 14 | |
| α-helix | 385-397 | 13 | |
| α-helix | 401-414 | 14 | |
| α-helix | 419-431 | 13 | |
| α-helix | 435-448 | 14 | |
| α-helix | 453-465 | 13 | |
| α-helix | 472-488 | 17 | |
| α-helix | 500-502 | 3 | |
| α-helix | 507-526 | 20 | |
| α-helix | 530-536 | 7 | |
| α-helix | 540-542 | 3 | |
| β-strand | 546-552 | 7 | 1 |
| α-helix | 559-564 | 6 | |
| α-helix | 567-570 | 4 | |
| β-strand | 576-582 | 7 | 1 |
| α-helix | 590-598 | 9 | |
| β-strand | 601-604 | 4 | 1 |
| α-helix | 605-607 | 3 | |
| α-helix | 611-620 | 10 | |
| β-strand | 625-628 | 4 | 1 |
| β-strand | 633 | 1 | 2 |
| α-helix | 639-642 | 4 | |
| β-strand | 648-651 | 4 | 1 |
| β-strand | 666-669 | 4 | 1 |
| α-helix | 676-681 | 6 | |
| β-strand | 685-688 | 4 | 1 |
| α-helix | 698-701 | 4 | |
| α-helix | 703-705 | 3 | |
| β-strand | 709-711 | 3 | 3 |
| β-strand | 724-727 | 4 | 3 |
| α-helix | 731-736 | 6 | |
| β-strand | 742-745 | 4 | 3 |
| β-strand | 763-767 | 5 | 3 |
| α-helix | 771-782 | 12 | |
| β-strand | 786-789 | 4 | 3 |
| β-strand | 792-796 | 5 | 3 |
| α-helix | 800-803 | 4 | |
| α-helix | 805-809 | 5 | |
| β-strand | 817-821 | 5 | 3 |
| α-helix | 822-824 | 3 | |
| β-strand | 832-835 | 4 | 4 |
| α-helix | 840-842 | 3 | |
| α-helix | 845-857 | 13 | |
| β-strand | 861-867 | 7 | 4 |
| α-helix | 870-872 | 3 | |
| α-helix | 873-882 | 10 | |
| α-helix | 887-889 | 3 | |
| β-strand | 890-894 | 5 | 4 |
| α-helix | 898-904 | 7 | |
| α-helix | 905-907 | 3 | |
| β-strand | 910-912 | 3 | 4 |
| α-helix | 921-928 | 8 | |
| β-strand | 933-934 | 2 | 4 |
| β-strand | 935 | 1 | 5 |
| α-helix | 941-943 | 3 | |
| α-helix | 945-953 | 9 | |
| α-helix | 956-958 | 3 | |
| β-strand | 959 | 1 | 5 |
| α-helix | 963-975 | 13 | |
| α-helix | 977-993 | 17 | |
| α-helix | 999-1018 | 20 | |
| α-helix | 1021-1023 | 3 | |
| β-strand | 1026 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23 | 1 | 2 |
| α-helix | 24-25 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | A, C | protein | 723 | Homo sapiens | O15294 (AlphaFold model) |
| Casein kinase II subunit alpha | B, D | protein | 14 | Homo sapiens | P68400 (AlphaFold model) |
>3TAX_1 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (chains A, C) GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQ EALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASI HKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLE KNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRV GYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQI PCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYII TDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNG IDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQIT INGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTL QMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLA DVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYED IAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK PVE
>3TAX_2 Casein kinase II subunit alpha (chains B, D) YPGGSTPVSSANMM
Water and common crystallization additives (SO4) are not listed.
A neutral diphosphate mimic crosslinks the active site of human O-GlcNAc transferase. Jiang, J., Lazarus, M.B., Pasquina, L. et al. Nat Chem Biol (2011) 8:72-77. DOI 10.1038/nchembio.711 · PubMed
Other PDB entries of the same protein (UniProt O15294 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3TAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.