Crystal Structure of human O-GlcNAc transferase bound to a peptide from HCF-1 pro-repeat 2 (1-26)E10A. Determined by X-ray diffraction at 1.88 Å resolution. Released 1 Jan 2014.
Explore 4N3A in 3D Show helices and sheets RCSB PDB PDBe
4N3A contains 46 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 314-329 | 16 | |
| α-helix | 333-346 | 14 | |
| α-helix | 351-363 | 13 | |
| α-helix | 367-380 | 14 | |
| α-helix | 385-397 | 13 | |
| α-helix | 401-414 | 14 | |
| α-helix | 419-432 | 14 | |
| α-helix | 435-448 | 14 | |
| α-helix | 453-465 | 13 | |
| α-helix | 472-488 | 17 | |
| α-helix | 497-502 | 6 | |
| α-helix | 507-526 | 20 | |
| α-helix | 530-534 | 5 | |
| α-helix | 540-542 | 3 | |
| β-strand | 546-552 | 7 | 1 |
| α-helix | 559-564 | 6 | |
| α-helix | 567-570 | 4 | |
| β-strand | 576-582 | 7 | 1 |
| α-helix | 590-598 | 9 | |
| β-strand | 601-604 | 4 | 1 |
| α-helix | 605-607 | 3 | |
| α-helix | 611-620 | 10 | |
| β-strand | 625-628 | 4 | 1 |
| α-helix | 639-642 | 4 | |
| β-strand | 648-651 | 4 | 1 |
| β-strand | 666-669 | 4 | 1 |
| α-helix | 676-681 | 6 | |
| β-strand | 685-688 | 4 | 1 |
| α-helix | 698-701 | 4 | |
| α-helix | 703-705 | 3 | |
| β-strand | 709-711 | 3 | 2 |
| β-strand | 724-727 | 4 | 2 |
| α-helix | 731-736 | 6 | |
| α-helix | 741 | 1 | |
| β-strand | 742-744 | 3 | 2 |
| β-strand | 764-767 | 4 | 2 |
| α-helix | 771-781 | 11 | |
| β-strand | 786-789 | 4 | 2 |
| β-strand | 792-796 | 5 | 2 |
| α-helix | 797-799 | 3 | |
| α-helix | 800-803 | 4 | |
| α-helix | 805-809 | 5 | |
| β-strand | 817-821 | 5 | 2 |
| α-helix | 822-825 | 4 | |
| β-strand | 832-835 | 4 | 3 |
| α-helix | 840-842 | 3 | |
| α-helix | 845-857 | 13 | |
| β-strand | 861-867 | 7 | 3 |
| α-helix | 870-872 | 3 | |
| α-helix | 873-882 | 10 | |
| α-helix | 887-889 | 3 | |
| β-strand | 890-894 | 5 | 3 |
| α-helix | 898-904 | 7 | |
| α-helix | 905-907 | 3 | |
| β-strand | 910-912 | 3 | 3 |
| α-helix | 921-928 | 8 | |
| β-strand | 933-934 | 2 | 3 |
| β-strand | 935 | 1 | 4 |
| α-helix | 941-943 | 3 | |
| α-helix | 945-953 | 9 | |
| α-helix | 956-958 | 3 | |
| β-strand | 959 | 1 | 4 |
| α-helix | 963-975 | 13 | |
| α-helix | 977-993 | 17 | |
| α-helix | 999-1018 | 20 | |
| α-helix | 1021-1023 | 3 | |
| β-strand | 1026 | 1 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-23 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit | A | protein | 723 | Homo sapiens | O15294 (AlphaFold model) |
| Host cell factor 1 | B | protein | 26 | Homo sapiens | P51610 (AlphaFold model) |
>4N3A_1 UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (chains A) GPGSCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQ EALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASI HKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLE KNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRV GYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQI PCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYII TDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNG IDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQIT INGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTL QMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLA DVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYED IAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK PVE
>4N3A_2 Host cell factor 1 (chains B) VRVCSNPPCATHETGTTNTATTATSN
| ID | Name | Formula | Copies |
|---|---|---|---|
| UDP | Uridine-5'-diphosphate | C9 H14 N2 O12 P2 | 1 |
HCF-1 is cleaved in the active site of O-GlcNAc transferase. Lazarus, M.B., Jiang, J., Kapuria, V. et al. Science (2013) 342:1235-1239. DOI 10.1126/science.1243990 · PubMed
Other PDB entries of the same protein (UniProt O15294 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4N3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.